PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cc06_g05470

Common Name

GSCOC_T00043099001

Organism

Coffea canephora

Taxonomic ID

49390

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea

Family

ZF-HD

Protein Properties

Length: 83aa MW: 8964.21 Da PI: 8.0584

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cc06_g05470	genome	CGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	97	1.4e-30	9	61	4	57
ZF-HD_dimer 4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 + Y++C+kNhA+++G +avDGC+Efmp+ g+ g++ al CaAC+CHRnFHR++v Cc06_g05470 9 ILYRDCRKNHAVNTGRYAVDGCREFMPA-GDAGSPGALLCAACDCHRNFHRKDV 61 78***********************9.8889*****************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	1.0E-15	1	61	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	2.4E-28	9	60	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	22.726	11	60	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	2.1E-25	11	60	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 83 aa Download sequence Send to blast
MAKTTSVMIL YRDCRKNHAV NTGRYAVDGC REFMPAGDAG SPGALLCAAC DCHRNFHRKD 60 VLLRGHDDTF PCDCSSVSTT PK*

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269\|PubMed:16412086, ECO:0000269\|PubMed:21059647, ECO:0000269\|PubMed:21455630}.
UniProt	Putative transcription factor. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020101124.1	1e-25	mini zinc finger protein 1-like
Swissprot	O64722	1e-19	ZHD3_ARATH; Zinc-finger homeodomain protein 3
Swissprot	Q9CA51	3e-20	MIF1_ARATH; Mini zinc finger protein 1
TrEMBL	A0A068V3L0	4e-54	A0A068V3L0_COFCA; Uncharacterized protein
STRING	VIT_08s0056g01130.t01	3e-24	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G74660.1	1e-22	mini zinc finger 1

Publications ? help Back to Top
González-Grandío E, et al. Abscisic acid signaling is controlled by a BRANCHED1/HD-ZIP I cascade in Arabidopsis axillary buds. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(2): p. E245-E254 [PMID:28028241] Li B, et al. Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis. Plant Cell, 2018. 30(1): p. 178-195 [PMID:29317470]