![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cc06_g16930 | ||||||||
| Common Name | GSCOC_T00004149001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 145aa MW: 16578.8 Da PI: 10.3618 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 105.8 | 3.7e-33 | 14 | 70 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep+YVNaKQy++Il+RRq Rak+e e+k+ +k+rkpylheSRh hA+rR+Rg+gGrF
Cc06_g16930 14 EEPVYVNAKQYHGILRRRQLRAKAELENKV-AKARKPYLHESRHLHAMRRARGCGGRF 70
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 8.8E-36 | 12 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 37.818 | 13 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 5.7E-29 | 15 | 70 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 3.1E-24 | 16 | 38 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 18 | 38 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 3.1E-24 | 47 | 70 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 145 aa Download sequence Send to blast |
MHDSRLALPL ELAEEPVYVN AKQYHGILRR RQLRAKAELE NKVAKARKPY LHESRHLHAM 60 RRARGCGGRF LSKKNVDKSD SRAASKKSID FNATPTEMKD SLGSQHPFSS TSQKSCNEVK 120 GFLLQEMQNT NTFEWGYQYH CKTQ* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 3e-23 | 14 | 77 | 2 | 65 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027066119.1 | 1e-106 | nuclear transcription factor Y subunit A-4-like isoform X5 | ||||
| Swissprot | Q84JP1 | 4e-33 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| Swissprot | Q945M9 | 5e-33 | NFYA9_ARATH; Nuclear transcription factor Y subunit A-9 | ||||
| TrEMBL | A0A068VCV4 | 1e-105 | A0A068VCV4_COFCA; Uncharacterized protein | ||||
| STRING | XP_010257210.1 | 2e-41 | (Nelumbo nucifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA11232 | 20 | 25 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.1 | 1e-29 | nuclear factor Y, subunit A7 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




