PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc06_g22630
Common NameGSCOC_T00010542001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family MYB_related
Protein Properties Length: 55aa    MW: 6245.29 Da    PI: 10.2526
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc06_g22630genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.51.8e-099431448
                     HHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 14 davkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     ++++  G g+W++ ++  g+ R++k+c++rw +yl
      Cc06_g22630  9 KYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 43
                     688999*************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.08147IPR017930Myb domain
CDDcd001670.00143843No hitNo description
Gene3DG3DSA:1.10.10.604.5E-11944IPR009057Homeodomain-like
PfamPF002496.0E-8943IPR001005SANT/Myb domain
SuperFamilySSF466891.3E-10953IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 55 aa     Download sequence    Send to blast
MGRAPCCEKY IQANGEGSWR SLPKNAGLLR CGKSCRLRWI NYLRSDLKPH PWIN*
Functional Description ? help Back to Top
Source Description
UniProtFlavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis primarily in cotyledons and leaves (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Triggered by HY5 in response to light and UV-B. {ECO:0000269|PubMed:19895401}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028945115.14e-24transcription factor MYB11-like
SwissprotQ9FJ074e-22MY111_ARATH; Transcription factor MYB111
TrEMBLA0A068VK296e-32A0A068VK29_COFCA; Uncharacterized protein
STRINGXP_008386735.11e-23(Malus domestica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.12e-24myb domain protein 111
Publications ? help Back to Top
  1. Pandey A,Misra P,Bhambhani S,Bhatia C,Trivedi PK
    Expression of Arabidopsis MYB transcription factor, AtMYB111, in tobacco requires light to modulate flavonol content.
    Sci Rep, 2014. 4: p. 5018
    [PMID:24846090]
  2. Lotkowska ME, et al.
    The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress.
    Plant Physiol., 2015. 169(3): p. 1862-80
    [PMID:26378103]
  3. Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
    The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors.
    Plant Physiol. Biochem., 2016. 102: p. 70-9
    [PMID:26913794]
  4. Zhou Z,Schenke D,Miao Y,Cai D
    Investigation of the crosstalk between the flg22 and the UV-B-induced flavonol pathway in Arabidopsis thaliana seedlings.
    Plant Cell Environ., 2017. 40(3): p. 453-458
    [PMID:28032363]
  5. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]
  6. Duan S, et al.
    Functional characterization of a heterologously expressed Brassica napus WRKY41-1 transcription factor in regulating anthocyanin biosynthesis in Arabidopsis thaliana.
    Plant Sci., 2018. 268: p. 47-53
    [PMID:29362083]