PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cc07_g16400

Common Name

GSCOC_T00037566001

Organism

Coffea canephora

Taxonomic ID

49390

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea

Family

WRKY

Protein Properties

Length: 104aa MW: 11826.5 Da PI: 9.9305

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cc07_g16400	genome	CGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	99	3e-31	16	74	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDgy+WrKYG+K+vk+s++pr+Y++C+s gC+vkk+ver+++dp++v++tYeg Hnhe Cc07_g16400 16 MDDGYKWRKYGKKMVKNSPNPRNYFKCSSGGCHVKKRVERDRDDPSYVITTYEGVHNHE 74 69********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	3.6E-33	4	76	IPR003657	WRKY domain
SuperFamily	SSF118290	1.44E-28	8	76	IPR003657	WRKY domain
PROSITE profile	PS50811	31.307	11	76	IPR003657	WRKY domain
SMART	SM00774	9.4E-35	16	75	IPR003657	WRKY domain
Pfam	PF03106	1.4E-24	17	74	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009867	Biological Process	jasmonic acid mediated signaling pathway
GO:0042742	Biological Process	defense response to bacterium
GO:0050832	Biological Process	defense response to fungus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 104 aa Download sequence Send to blast
MGRKVAFRTK SKLDVMDDGY KWRKYGKKMV KNSPNPRNYF KCSSGGCHVK KRVERDRDDP 60 SYVITTYEGV HNHESPCVVY HLPPMMPMGG FSLQESYTPS SSS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	3e-26	6	77	7	78	Probable WRKY transcription factor 4
2lex_A	3e-26	6	77	7	78	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269\|PubMed:21030507}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027076705.1	1e-73	probable WRKY transcription factor 50 isoform X2
Swissprot	Q93WU9	8e-40	WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBL	A0A068UWG5	5e-71	A0A068UWG5_COFCA; Uncharacterized protein
STRING	XP_010261070.1	7e-48	(Nelumbo nucifera)
STRING	XP_006427979.1	3e-48	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2124	24	62

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64810.1	3e-42	WRKY DNA-binding protein 51

Publications ? help Back to Top
Yan C, et al. Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis. Mol. Cell, 2018. 70(1): p. 136-149.e7 [PMID:29625034]