PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cc10_g13160

Common Name

GSCOC_T00035332001

Organism

Coffea canephora

Taxonomic ID

49390

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea

Family

MYB

Protein Properties

Length: 141aa MW: 16458.4 Da PI: 10.3679

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cc10_g13160	genome	CGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	60.6	3.4e-19	18	63	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ Cc10_g13160 18 RGHWRPAEDERLRQLVEQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 63 899***************************.*********996 PP
2	Myb_DNA-binding	59.6	6.9e-19	70	113	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++++eE+e+l+ a++ +G++ W++I+r ++ gRt++ +k++w+ Cc10_g13160 70 RRPFSEEEEERLLAAHRIHGNK-WALISRLFP-GRTDNAVKNHWHV 113 679*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	19.502	13	64	IPR017930	Myb domain
SuperFamily	SSF46689	4.49E-30	17	111	IPR009057	Homeodomain-like
SMART	SM00717	9.5E-15	17	66	IPR001005	SANT/Myb domain
Pfam	PF00249	3.7E-18	18	63	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.4E-27	19	71	IPR009057	Homeodomain-like
CDD	cd00167	3.88E-13	21	62	No hit	No description
PROSITE profile	PS51294	26.905	65	119	IPR017930	Myb domain
SMART	SM00717	1.2E-15	69	117	IPR001005	SANT/Myb domain
Pfam	PF00249	8.6E-16	70	112	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.4E-21	72	117	IPR009057	Homeodomain-like
CDD	cd00167	4.81E-7	81	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 141 aa Download sequence Send to blast
MDETGGGASS DDARTCPRGH WRPAEDERLR QLVEQYGPQN WNSIAEKLQG RSGKSCRLRW 60 FNQLDPRINR RPFSEEEEER LLAAHRIHGN KWALISRLFP GRTDNAVKNH WHVIMARRQR 120 EQSKVCGKRS YHDTQSVLWI *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	7e-32	18	118	4	104	MYB PROTO-ONCOGENE PROTEIN
1mse_C	7e-32	18	118	4	104	C-Myb DNA-Binding Domain
1msf_C	7e-32	18	118	4	104	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269\|PubMed:20305120}.
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.
UniProt	INDUCTION: Induced by wounding. {ECO:0000269\|PubMed:20305120}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027093187.1	3e-97	transcription factor MYB101-like
Swissprot	Q5NBM8	2e-65	CSA_ORYSJ; Transcription factor CSA
Swissprot	Q6R0C4	1e-66	MYB52_ARATH; Transcription factor MYB52
TrEMBL	A0A068UTV6	1e-100	A0A068UTV6_COFCA; Uncharacterized protein
STRING	XP_006473036.1	6e-83	(Citrus sinensis)
STRING	XP_006434346.1	6e-83	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1784	24	66

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G17950.1	9e-65	myb domain protein 52

Publications ? help Back to Top
Leonard LM,Follette VM Sexual functioning in women reporting a history of child sexual abuse: review of the empirical literature and clinical implications. Annu Rev Sex Res, 2002. 13: p. 346-88 [PMID:12836736] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Wang L,Li X,Chen Z Sulfated modification of the polysaccharides obtained from defatted rice bran and their antitumor activities. Int. J. Biol. Macromol., 2009. 44(2): p. 211-4 [PMID:19135473] Wang L,Huang H,Wei Y,Li X,Chen Z Characterization and anti-tumor activities of sulfated polysaccharide SRBPS2a obtained from defatted rice bran. Int. J. Biol. Macromol., 2009. 45(4): p. 427-31 [PMID:19549538] Zhang H, et al. Carbon starved anther encodes a MYB domain protein that regulates sugar partitioning required for rice pollen development. Plant Cell, 2010. 22(3): p. 672-89 [PMID:20305120] Zhang H, et al. Mutation in CSA creates a new photoperiod-sensitive genic male sterile line applicable for hybrid rice seed production. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(1): p. 76-81 [PMID:23256151] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Zhu X, et al. Brassinosteroids promote development of rice pollen grains and seeds by triggering expression of Carbon Starved Anther, a MYB domain protein. Plant J., 2015. 82(4): p. 570-81 [PMID:25754973] Li X, et al. Metabolic and transcriptomic signatures of rice floral organs reveal sugar starvation as a factor in reproductive failure under heat and drought stress. Plant Cell Environ., 2015. 38(10): p. 2171-92 [PMID:25828772] Shaar-Moshe L,Hübner S,Peleg Z Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach. BMC Plant Biol., 2015. 15: p. 111 [PMID:25935420] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562]