![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cc10_g16120 | ||||||||
| Common Name | GSCOC_T00033824001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 127aa MW: 13941.9 Da PI: 7.7321 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 119.9 | 1.6e-37 | 3 | 88 | 54 | 139 |
Whirly 54 sfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
falsatev+++++++++++ effhdpa+ +sn+G+vrk+l+++P++dGsG+f++l+v n+++k+ne+++vPv+ aefav+r++++
Cc10_g16120 3 CFALSATEVGSMINMGPQDTREFFHDPAMLSSNAGQVRKSLSIKPHADGSGYFFSLNVVNNILKTNERLVVPVTAAEFAVMRTAFS 88
69*********************************************************************************995 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF54447 | 3.84E-37 | 3 | 124 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene3D | G3DSA:2.30.31.10 | 1.8E-41 | 3 | 105 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 1.1E-32 | 3 | 85 | IPR013742 | Plant transcription factor |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 127 aa Download sequence Send to blast |
MHCFALSATE VGSMINMGPQ DTREFFHDPA MLSSNAGQVR KSLSIKPHAD GSGYFFSLNV 60 VNNILKTNER LVVPVTAAEF AVMRTAFSFA LPRIMGWDQY SNQPLGTAHK SPSKVLPHLT 120 DSEWDK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3n1h_A | 5e-56 | 2 | 105 | 68 | 171 | StWhy2 |
| 3n1i_A | 5e-56 | 2 | 105 | 68 | 171 | protein StWhy2 |
| 3n1j_A | 5e-56 | 2 | 105 | 68 | 171 | Protein StWhy2 |
| 3n1k_A | 5e-56 | 2 | 105 | 68 | 171 | protein StWhy2 |
| 3n1l_A | 5e-56 | 2 | 105 | 68 | 171 | protein StWhy2 |
| 3r9y_A | 5e-56 | 2 | 105 | 68 | 171 | Why2 protein |
| 3r9z_A | 5e-56 | 2 | 105 | 68 | 171 | Why2 protein |
| 3ra0_A | 5e-56 | 2 | 105 | 68 | 171 | Why2 protein |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027092747.1 | 1e-88 | single-stranded DNA-binding protein WHY2, mitochondrial-like | ||||
| Swissprot | D9J034 | 3e-63 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
| TrEMBL | A0A068UV66 | 3e-90 | A0A068UV66_COFCA; Uncharacterized protein | ||||
| STRING | Solyc11g044750.1.1 | 8e-62 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA9782 | 22 | 28 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71260.1 | 4e-52 | WHIRLY 2 | ||||




