![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cc11_g04550 | ||||||||
| Common Name | GSCOC_T00004809001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 96aa MW: 10624.4 Da PI: 10.7153 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 76.8 | 2.7e-24 | 10 | 48 | 24 | 62 |
zf-Dof 24 yslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
ysl+qPr+fCk+CrryWtkGGalrnv +Ggg+rknkks+
Cc11_g04550 10 YSLAQPRHFCKTCRRYWTKGGALRNVLIGGGCRKNKKSK 48
9***********************************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50884 | 17.541 | 1 | 46 | IPR003851 | Zinc finger, Dof-type |
| ProDom | PD007478 | 4.0E-14 | 10 | 46 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 3.3E-18 | 10 | 46 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MQFAKHKGFY SLAQPRHFCK TCRRYWTKGG ALRNVLIGGG CRKNKKSKPP SRLTVDPKDT 60 NMTSDIGGLK FFHGLTPAMD FQLGGITSYL LPEGF* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027074289.1 | 2e-48 | dof zinc finger protein DOF5.7-like | ||||
| Refseq | XP_027180024.1 | 2e-48 | dof zinc finger protein DOF5.7-like | ||||
| Swissprot | Q9LSL6 | 1e-20 | DOF57_ARATH; Dof zinc finger protein DOF5.7 | ||||
| TrEMBL | A0A068VBC4 | 9e-65 | A0A068VBC4_COFCA; Uncharacterized protein | ||||
| STRING | XP_006426240.1 | 1e-38 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA5242 | 22 | 34 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G65590.1 | 6e-23 | Dof family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




