PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc11_g13270
Common NameGSCOC_T00032203001
Organism
Coffea canephora
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family bHLH
Protein Properties Length: 93aa    MW: 10474.8 Da    PI: 9.362
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc11_g13270genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH26.61.1e-0819591454
                 HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
          HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                 d+i +   +L++l+P++ + +s K+s + +L+++++YI+sL
  Cc11_g13270 19 DQIADLVTKLQQLIPELRRRRSDKVSASKVLQETCNYIRSL 59
                 67889999********889********************99 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.103.9E-9376IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.512559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.75E-91977IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.6E-61959IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MSSRRSRSRQ SGASRITDDQ IADLVTKLQQ LIPELRRRRS DKVSASKVLQ ETCNYIRSLH  60
REVDDLSDRL SELLESTDSD SAQAAIIRSL LM*
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868}.
UniProtAtypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex. {ECO:0000269|PubMed:16786307, ECO:0000269|PubMed:23224238}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at midday. {ECO:0000269|PubMed:16786307}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027095541.17e-57transcription factor PRE6
RefseqXP_027153435.17e-57transcription factor PRE6
SwissprotQ8GW325e-40PRE6_ARATH; Transcription factor PRE6
SwissprotQ9LJX14e-40PRE5_ARATH; Transcription factor PRE5
TrEMBLA0A068TW952e-55A0A068TW95_COFCA; Uncharacterized protein
STRINGEMJ281144e-44(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35324161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.11e-29bHLH family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gommers CM, et al.
    Molecular Profiles of Contrasting Shade Response Strategies in Wild Plants: Differential Control of Immunity and Shoot Elongation.
    Plant Cell, 2017. 29(2): p. 331-344
    [PMID:28138015]
  3. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]
  4. Zheng K, et al.
    Involvement of PACLOBUTRAZOL RESISTANCE6/KIDARI, an Atypical bHLH Transcription Factor, in Auxin Responses in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1813
    [PMID:29114256]