PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ciclev10005788m

Common Name

CICLE_v10005747mg

Organism

Citrus clementina

Taxonomic ID

85681

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

ARR-B

Protein Properties

Length: 233aa MW: 26790 Da PI: 7.5457

Description

ARR-B family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ciclev10005788m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	74.9	1.1e-23	169	219	1	52
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 kpr+ W+ eLH++Fv+av L G++kA+Pk+ilelm+v+gLt+e+v+SHLQ Ciclev10005788m 169 KPRVFWSVELHQQFVSAVIWL-GIDKAVPKKILELMNVPGLTRENVASHLQV 219 79*****************.***************************5 PP
2	Response_reg	50.3	1.4e-17	20	118	1	108
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 vl+vdD+p+ +++l+++l+k y ev+ + +e al++l+ ++ +D+++ D+ mp+mdG++l ++ e +lp+i v + + Ciclev10005788m 20 VLVVDDDPIWLRILEKMLRKCLY-EVTKCNRAEIALDMLRMSKngYDIVISDVHMPDMDGFKLHEQVGLEM-DLPVINVM---------KGVTH 102 89*******************.***********888888*******************95543.67777443.........55556 PP TESEEEESS--HHHHH CS Response_reg 93 GakdflsKpfdpeelv 108 Ga +l Kp+ ++el+ Ciclev10005788m 103 GACNYLLKPIRIKELR 118 6666666666666665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF52172	3.98E-27	17	133	IPR011006	CheY-like superfamily
Gene3D	G3DSA:3.40.50.2300	4.3E-31	17	149	No hit	No description
SMART	SM00448	1.6E-15	18	121	IPR001789	Signal transduction response regulator, receiver domain
PROSITE profile	PS50110	25.603	19	125	IPR001789	Signal transduction response regulator, receiver domain
Pfam	PF00072	7.7E-15	20	119	IPR001789	Signal transduction response regulator, receiver domain
CDD	cd00156	9.47E-20	21	125	No hit	No description
SuperFamily	SSF46689	3.23E-16	166	222	IPR009057	Homeodomain-like
PROSITE profile	PS51294	10.345	166	225	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	4.7E-23	168	218	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.6E-21	169	221	IPR006447	Myb domain, plants

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000160	Biological Process	phosphorelay signal transduction system
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 233 aa Download sequence Send to blast
MSPASSSVAV SDQFPAGLRV LVVDDDPIWL RILEKMLRKC LYEVTKCNRA EIALDMLRMS 60 KNGYDIVISD VHMPDMDGFK LHEQVGLEMD LPVINVMKGV THGACNYLLK PIRIKELRNI 120 WQHVAQQPKP FEESDDSYSV NQGNWRTSNR RKDEEEEAEK RDDTSTLKKP RVFWSVELHQ 180 QFVSAVIWLG IDKAVPKKIL ELMNVPGLTR ENVASHLQVL YKTLELRKFC RI*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	6e-18	168	218	4	54	ARR10-B
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Detected in the whole plant. Predominantly expressed in pollen. {ECO:0000269\|PubMed:11370868, ECO:0000269\|PubMed:15173562, ECO:0000269\|PubMed:9891419}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269\|PubMed:11370868, ECO:0000269\|PubMed:11574878, ECO:0000269\|PubMed:15282545, ECO:0000269\|PubMed:16407152}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024047531.1	1e-115	two-component response regulator ARR2
Swissprot	Q9ZWJ9	2e-93	ARR2_ARATH; Two-component response regulator ARR2
TrEMBL	V4RY43	1e-172	V4RY43_9ROSI; Uncharacterized protein
STRING	XP_006419446.1	1e-160	(Citrus clementina)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G16110.1	3e-88	response regulator 2

Link Out ? help Back to Top
Phytozome	Ciclev10005788m
Entrez Gene	18031319

Publications ? help Back to Top
Takahashi N, et al. Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots. Curr. Biol., 2013. 23(18): p. 1812-7 [PMID:24035544] Ge XM, et al. Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis. Plant J., 2015. 82(1): p. 138-50 [PMID:25704455] Takahashi N,Umeda M Cytokinins promote onset of endoreplication by controlling cell cycle machinery. Plant Signal Behav, 2014. 9(8): p. e29396 [PMID:25763620] Kobayashi K, et al. Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling. Plant Physiol., 2017. 173(4): p. 2340-2355 [PMID:28193764] Arnaud D, et al. Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis. Plant Cell, 2017. 29(3): p. 543-559 [PMID:28254779] Zhang TQ, et al. A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration. Plant Cell, 2017. 29(5): p. 1073-1087 [PMID:28389585] Meng WJ, et al. Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL. Plant Cell, 2017. 29(6): p. 1357-1372 [PMID:28576846] Zhang F,May A,Irish VF Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL. Trends Plant Sci., 2017. 22(10): p. 815-817 [PMID:28886911] Takatsuka H,Higaki T,Umeda M Actin Reorganization Triggers Rapid Cell Elongation in Roots. Plant Physiol., 2018. 178(3): p. 1130-1141 [PMID:30185441]