PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ciclev10006413m

Common Name

CICLE_v10006413mg

Organism

Citrus clementina

Taxonomic ID

85681

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

bHLH

Protein Properties

Length: 140aa MW: 16037.3 Da PI: 7.4136

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ciclev10006413m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	46	9.2e-15	66	117	2	55
HHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS HLH 2 rrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 + hn+ Er RR++iNs ++ Lr+llP a + kKls +++ ++ +YI +Lq Ciclev10006413m 66 KLYHNASERDRRKKINSLYSSLRSLLPVA--DQTKKLSIPATVSRVLKYIPELQ 117 667***********************6..48888*************998 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50888	13.802	64	116	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
CDD	cd00083	1.43E-5	65	121	No hit	No description
SuperFamily	SSF47459	1.03E-16	65	134	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Pfam	PF00010	5.6E-12	66	117	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Gene3D	G3DSA:4.10.280.10	2.4E-14	66	134	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SMART	SM00353	8.7E-11	70	122	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010106	Biological Process	cellular response to iron ion starvation
GO:0055072	Biological Process	iron ion homeostasis
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 140 aa Download sequence Send to blast
MCALFPPFFP SLGWPLEINP ICHQQDYITE TIEESPQFPQ ESEPQAEFDR SASFSANSGD 60 PTMVKKLYHN ASERDRRKKI NSLYSSLRSL LPVADQTKKL SIPATVSRVL KYIPELQQQV 120 ERLMQKKEEL LSKISKPGEI

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Roots. {ECO:0000269\|PubMed:12679534}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by OBP3, auxin and salicylic acid (SA). Repressed by jasmonic acid (JA), UV LIGHT, and heat treatments. Up regulated by iron deficiency in roots and leaves, as well as by nickel, high zinc or high copper treatments. Repressed by high iron, low copper and low zinc treatments. {ECO:0000269\|PubMed:12679534, ECO:0000269\|PubMed:12887587, ECO:0000269\|PubMed:17516080}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006421111.2	1e-95	LOW QUALITY PROTEIN: uncharacterized protein LOC18033443
Refseq	XP_006494391.2	2e-97	transcription factor ORG2
Swissprot	Q9M1K1	1e-39	ORG2_ARATH; Transcription factor ORG2
TrEMBL	A0A067DMC3	3e-97	A0A067DMC3_CITSI; Uncharacterized protein
TrEMBL	A0A2H5QLA5	3e-97	A0A2H5QLA5_CITUN; Uncharacterized protein
TrEMBL	V4SBL6	5e-98	V4SBL6_9ROSI; Uncharacterized protein (Fragment)
STRING	XP_006421111.1	8e-99	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM482	28	153

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G56970.1	1e-38	bHLH family protein

Link Out ? help Back to Top
Phytozome	Ciclev10006413m
Entrez Gene	18033443

Publications ? help Back to Top
Skinner MK,Rawls A,Wilson-Rawls J,Roalson EH Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature. Differentiation, 2010. 80(1): p. 1-8 [PMID:20219281] Matsuoka K, et al. Gibberellin-induced expression of Fe uptake-related genes in Arabidopsis. Plant Cell Physiol., 2014. 55(1): p. 87-98 [PMID:24192296] Li X,Zhang H,Ai Q,Liang G,Yu D Two bHLH Transcription Factors, bHLH34 and bHLH104, Regulate Iron Homeostasis in Arabidopsis thaliana. Plant Physiol., 2016. 170(4): p. 2478-93 [PMID:26921305] Shen C, et al. Involvement of endogenous salicylic acid in iron-deficiency responses in Arabidopsis. J. Exp. Bot., 2016. 67(14): p. 4179-93 [PMID:27208542] Liang G,Zhang H,Li X,Ai Q,Yu D bHLH transcription factor bHLH115 regulates iron homeostasis in Arabidopsis thaliana. J. Exp. Bot., 2017. 68(7): p. 1743-1755 [PMID:28369511] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Kailasam S,Wang Y,Lo JC,Chang HF,Yeh KC S-Nitrosoglutathione works downstream of nitric oxide to mediate iron-deficiency signaling in Arabidopsis. Plant J., 2018. 94(1): p. 157-168 [PMID:29396986] Kurt F,Filiz E Genome-wide and comparative analysis of bHLH38, bHLH39, bHLH100 and bHLH101 genes in Arabidopsis, tomato, rice, soybean and maize: insights into iron (Fe) homeostasis. Biometals, 2018. 31(4): p. 489-504 [PMID:29546482]