![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ciclev10006743m | ||||||||
| Common Name | CICLE_v10006743mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 80aa MW: 8872.27 Da PI: 10.1423 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 46.9 | 3.4e-15 | 2 | 50 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
k+ienk r +tfskR gi KKA+ L +L ++a+++fs++gk y +
Ciclev10006743m 2 KKIENKYDRMITFSKRISGIYKKASKLVTLPRGDIAIVVFSPSGKPYSF 50
78*******************************************8887 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 3.79E-18 | 1 | 69 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 8.4E-11 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 18.53 | 1 | 54 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 8.4E-18 | 3 | 50 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-5 | 16 | 31 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-5 | 31 | 52 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MKKIENKYDR MITFSKRISG IYKKASKLVT LPRGDIAIVV FSPSGKPYSF GHPSIEAVAN 60 HFLGLDQPPN DNNHPLFEV* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in the embryo at the globular stage and in endosperm nuclei and chalazal endosperm of developing seeds. {ECO:0000269|PubMed:16899218}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves and shoot apices. {ECO:0000269|PubMed:16899218}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may function as a floral promoter operating upstream of known floral activators in the autonomous pathway. {ECO:0000269|PubMed:16899218}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024043348.1 | 2e-35 | agamous-like MADS-box protein AGL61 | ||||
| Swissprot | Q9LMM8 | 1e-16 | AGL28_ARATH; Agamous-like MADS-box protein AGL28 | ||||
| TrEMBL | A0A2H5QMZ2 | 4e-51 | A0A2H5QMZ2_CITUN; Uncharacterized protein | ||||
| TrEMBL | V4S6V0 | 4e-51 | V4S6V0_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006421355.1 | 7e-52 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM86 | 28 | 390 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G34440.1 | 2e-19 | AGAMOUS-like 29 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Ciclev10006743m |
| Entrez Gene | 18032924 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




