![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ciclev10006958m | ||||||||
| Common Name | CICLE_v10006958mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 93aa MW: 10224.7 Da PI: 9.9815 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 58 | 1.2e-18 | 17 | 63 | 1 | 47 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
k+ien+ r +tfskRr gi KKA+EL +L++ae+ +++fs++gk +
Ciclev10006958m 17 KKIENEDDRMITFSKRRSGIHKKASELVTLTGAEIGIVVFSPSGKPF 63
78******************************************965 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 24.278 | 9 | 69 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 8.9E-28 | 9 | 68 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 9.16E-25 | 10 | 83 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.5E-19 | 11 | 31 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.4E-23 | 18 | 65 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.5E-19 | 31 | 46 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.5E-19 | 46 | 67 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 93 aa Download sequence Send to blast |
MVQGPCKTRG RQKIEIKKIE NEDDRMITFS KRRSGIHKKA SELVTLTGAE IGIVVFSPSG 60 KPFSFGHPSL EAVANQEHPN DNTHLLVELT AR* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in the final stages of embryo sac development. {ECO:0000269|PubMed:18713950}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed exclusively in the central cell of the female gametophyte and in early endosperm. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015389346.1 | 3e-54 | polygalacturonase-like | ||||
| Swissprot | Q4PSU4 | 5e-26 | AGL61_ARATH; Agamous-like MADS-box protein AGL61 | ||||
| TrEMBL | V4SC85 | 1e-61 | V4SC85_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006421346.1 | 2e-62 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM86 | 28 | 390 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G24840.1 | 2e-28 | AGAMOUS-like 61 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Ciclev10006958m |
| Entrez Gene | 18032960 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




