PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ciclev10009879m

Common Name

CICLE_v10009879mg

Organism

Citrus clementina

Taxonomic ID

85681

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

SBP

Protein Properties

Length: 131aa MW: 14726.4 Da PI: 8.4987

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ciclev10009879m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	134.5	3.4e-42	38	115	1	78
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +C ve+C +dl++a++yhrrhkvCe+hskapvv+v+gl+qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++a Ciclev10009879m 38 CCMVEKCGTDLTDARRYHRRHKVCETHSKAPVVIVAGLRQRFCQQCSRFHELYEFDETKRSCRRRLAGHNERRRKSTA 115 6**************************************************************************976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF037575	4.5E-56	1	125	IPR017238	Squamosa promoter-binding protein
Gene3D	G3DSA:4.10.1100.10	1.4E-34	33	100	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	32.317	36	113	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	2.49E-39	37	117	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	1.8E-32	39	112	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009908	Biological Process	flower development
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046872	Molecular Function	metal ion binding

Sequence ? help Back to Top
Protein Sequence Length: 131 aa Download sequence Send to blast
MDNDMEEEEG GVDCYADDER KKKATGRRAA PAGTSSPCCM VEKCGTDLTD ARRYHRRHKV 60 CETHSKAPVV IVAGLRQRFC QQCSRFHELY EFDETKRSCR RRLAGHNERR RKSTAETTGE 120 GSSCRGVGPQ *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	2e-34	39	112	11	84	squamosa promoter binding protein-like 4
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269\|PubMed:16861571}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00359	DAP	Transfer from AT3G15270	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305\|PubMed:16861571}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006451806.1	1e-91	squamosa promoter-binding-like protein 13
Refseq	XP_006464784.1	1e-91	squamosa promoter-binding-like protein 13
Swissprot	Q38740	1e-41	SBP2_ANTMA; Squamosa promoter-binding protein 2
Swissprot	Q6Z461	1e-41	SPL13_ORYSJ; Squamosa promoter-binding-like protein 13
TrEMBL	A0A067FH62	3e-90	A0A067FH62_CITSI; Uncharacterized protein
TrEMBL	A0A2H5QHN5	3e-90	A0A2H5QHN5_CITUN; Uncharacterized protein
TrEMBL	V4URD2	3e-90	V4URD2_9ROSI; Squamosa promoter-binding protein 1
STRING	XP_006464784.1	6e-91	(Citrus sinensis)
STRING	XP_006451806.1	6e-91	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM868	28	118

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G53160.2	2e-42	squamosa promoter binding protein-like 4

Link Out ? help Back to Top
Phytozome	Ciclev10009879m
Entrez Gene	18054083

Publications ? help Back to Top
Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]