![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ciclev10013218m | ||||||||
| Common Name | CICLE_v10013218mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 90aa MW: 9781.63 Da PI: 10.4018 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 134.4 | 2.7e-42 | 22 | 89 | 3 | 70 |
S1FA 3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
v+ + akG+nPGlivllvvgglllvfl+gnyily+yaqk+lPP+kkkPvskkk+k+e+lkqGv++PGe
Ciclev10013218m 22 VKDAGAKGFNPGLIVLLVVGGLLLVFLIGNYILYMYAQKTLPPKKKKPVSKKKMKKERLKQGVSAPGE 89
566789*************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 1.0E-40 | 26 | 89 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MDEEFEFGDK APPSFDRVGN TVKDAGAKGF NPGLIVLLVV GGLLLVFLIG NYILYMYAQK 60 TLPPKKKKPV SKKKMKKERL KQGVSAPGE* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Ccl.19791 | 1e-145 | abscission zone| flower| fruit | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006428828.1 | 4e-57 | DNA-binding protein S1FA | ||||
| Refseq | XP_006480642.1 | 4e-57 | DNA-binding protein S1FA | ||||
| Swissprot | P42553 | 3e-16 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
| TrEMBL | V4S3V4 | 8e-56 | V4S3V4_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006480642.1 | 1e-56 | (Citrus sinensis) | ||||
| STRING | XP_006428828.1 | 1e-56 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2823 | 27 | 69 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Ciclev10013218m |
| Entrez Gene | 18039066 |




