![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ciclev10013802m | ||||||||
| Common Name | CICLE_v10013802mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 228aa MW: 25705.3 Da PI: 9.1919 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 67 | 1.9e-21 | 18 | 64 | 3 | 49 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
i k n qvtfskRr+g++KKA+ELS+LC++++a+i+fs+ +k + +
Ciclev10013802m 18 IPKKNNLQVTFSKRRAGVFKKASELSTLCGVDIALIVFSPANKAFSF 64
7789999**********************************997766 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.1E-30 | 8 | 67 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 23.296 | 8 | 68 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.59E-33 | 9 | 77 | No hit | No description |
| SuperFamily | SSF55455 | 4.32E-26 | 9 | 91 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.3E-17 | 10 | 30 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.9E-23 | 17 | 64 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.3E-17 | 30 | 45 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.3E-17 | 45 | 66 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 228 aa Download sequence Send to blast |
MEMKKPCAGR QKIAISKIPK KNNLQVTFSK RRAGVFKKAS ELSTLCGVDI ALIVFSPANK 60 AFSFGHPNVD SILDLYLARN PNPPSESSTD RLIEAHRNAN IRELNMQLTQ VLHQLEVEKK 120 HGEVLSEIRK ASCRQCWWEA PINELGLHEL EQLKTAMEEL KKNVEQQANK ILIDYKNNPS 180 PFFGVNNQNI NPHHHQSKLP LGIPPSSNDA LPNFYSSGFG HYHDHQQ* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3kov_A | 7e-18 | 9 | 95 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3kov_B | 7e-18 | 9 | 95 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3kov_I | 7e-18 | 9 | 95 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3kov_J | 7e-18 | 9 | 95 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_A | 7e-18 | 9 | 95 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_B | 7e-18 | 9 | 95 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_C | 7e-18 | 9 | 95 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_D | 7e-18 | 9 | 95 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_I | 7e-18 | 9 | 95 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_J | 7e-18 | 9 | 95 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 5f28_A | 8e-18 | 9 | 95 | 2 | 87 | MEF2C |
| 5f28_B | 8e-18 | 9 | 95 | 2 | 87 | MEF2C |
| 5f28_C | 8e-18 | 9 | 95 | 2 | 87 | MEF2C |
| 5f28_D | 8e-18 | 9 | 95 | 2 | 87 | MEF2C |
| 6c9l_A | 8e-18 | 9 | 92 | 2 | 85 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 8e-18 | 9 | 92 | 2 | 85 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 8e-18 | 9 | 92 | 2 | 85 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 8e-18 | 9 | 92 | 2 | 85 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 8e-18 | 9 | 92 | 2 | 85 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 8e-18 | 9 | 92 | 2 | 85 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed during the syncytial endosperm development. {ECO:0000269|PubMed:18334668}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the endosperm but not in the embryo. Detected in young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:18334668}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006480851.1 | 1e-168 | agamous-like MADS-box protein AGL62 | ||||
| Swissprot | Q9FKK2 | 2e-53 | AGL62_ARATH; Agamous-like MADS-box protein AGL62 | ||||
| TrEMBL | V4URY1 | 1e-168 | V4URY1_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006429054.1 | 1e-169 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM86 | 28 | 390 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G60440.1 | 7e-56 | AGAMOUS-like 62 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Ciclev10013802m |
| Entrez Gene | 18040030 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




