![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ciclev10023393m | ||||||||
| Common Name | CICLE_v10023393mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | ERF | ||||||||
| Protein Properties | Length: 153aa MW: 16647.1 Da PI: 5.3349 | ||||||||
| Description | ERF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | AP2 | 57.1 | 4.6e-18 | 19 | 70 | 2 | 55 |
AP2 2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55
+y+GVr ++ +g+++AeIrd + g r +lg+f taeeAa+a+++a+ +++g
Ciclev10023393m 19 HYRGVRKRP-WGKFAAEIRDSTRHG-GPRLWLGTFSTAEEAARAYDRAAFAMRG 70
7********.**********44433.4*************************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51032 | 22.932 | 19 | 78 | IPR001471 | AP2/ERF domain |
| Pfam | PF00847 | 2.0E-13 | 19 | 70 | IPR001471 | AP2/ERF domain |
| SMART | SM00380 | 7.8E-35 | 19 | 84 | IPR001471 | AP2/ERF domain |
| SuperFamily | SSF54171 | 1.5E-21 | 19 | 80 | IPR016177 | DNA-binding domain |
| Gene3D | G3DSA:3.30.730.10 | 4.9E-30 | 19 | 80 | IPR001471 | AP2/ERF domain |
| CDD | cd00018 | 1.56E-29 | 19 | 79 | No hit | No description |
| PRINTS | PR00367 | 4.2E-11 | 20 | 31 | IPR001471 | AP2/ERF domain |
| PRINTS | PR00367 | 4.2E-11 | 44 | 60 | IPR001471 | AP2/ERF domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 153 aa Download sequence Send to blast |
MEGINRGKKK EEEEETSVHY RGVRKRPWGK FAAEIRDSTR HGGPRLWLGT FSTAEEAARA 60 YDRAAFAMRG PLAILNFPDE HFSSGVGSSS SSSTSSSVSS SSSSSSSVSQ NVETGGTDHE 120 GGGKEVFEIE YFDDKLLEDL LNFEESNNKT KK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5wx9_A | 6e-31 | 20 | 152 | 15 | 130 | Ethylene-responsive transcription factor ERF096 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006443854.1 | 1e-107 | ethylene-responsive transcription factor ERF096 | ||||
| Refseq | XP_024954058.1 | 1e-107 | ethylene-responsive transcription factor ERF096-like | ||||
| Swissprot | Q9LTC5 | 3e-37 | ERF98_ARATH; Ethylene-responsive transcription factor ERF098 | ||||
| TrEMBL | V4VUZ4 | 1e-105 | V4VUZ4_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006480089.1 | 1e-106 | (Citrus sinensis) | ||||
| STRING | XP_006443854.1 | 1e-106 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM10 | 28 | 1650 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G23230.1 | 1e-24 | ERF family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Ciclev10023393m |
| Entrez Gene | 18047855 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




