![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ciclev10024111m | ||||||||
| Common Name | CICLE_v10024111mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 92aa MW: 11108.7 Da PI: 10.0957 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 25.3 | 3.5e-08 | 31 | 70 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
++++E++l+++ k+ G + W++Ia +++ gR ++++ +w
Ciclev10024111m 31 MSEQEEDLIYRMYKLVGDR-WALIAGRIP-GRKAEEIERFWI 70
79***************99.*********.*********995 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 1.8E-5 | 27 | 75 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.70E-5 | 30 | 69 | No hit | No description |
| Pfam | PF00249 | 1.8E-7 | 31 | 70 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 5.07E-7 | 32 | 70 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 5.8E-10 | 32 | 70 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010091 | Biological Process | trichome branching | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 92 aa Download sequence Send to blast |
MDKRRRKQAK TTTTTFYSEE VSSIEWEFIN MSEQEEDLIY RMYKLVGDRW ALIAGRIPGR 60 KAEEIERFWI MRHGQAFADR RRELRIYNSK S* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 1 | 7 | DKRRRKQ |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Ubiquitous in young leaves. Later, restricted to the leaf base in the trichome initiation zone. In mature leaves, confined to trichome cells. {ECO:0000269|PubMed:12356720}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, siliques and inflorescences. {ECO:0000269|PubMed:12356720}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006444875.1 | 4e-61 | transcription factor CPC | ||||
| Refseq | XP_006491245.1 | 4e-61 | transcription factor CPC | ||||
| Swissprot | Q8GV05 | 2e-37 | TRY_ARATH; Transcription factor TRY | ||||
| TrEMBL | A0A067H333 | 8e-60 | A0A067H333_CITSI; Uncharacterized protein | ||||
| TrEMBL | A0A2H5PG76 | 8e-60 | A0A2H5PG76_CITUN; Uncharacterized protein | ||||
| TrEMBL | V4U236 | 8e-60 | V4U236_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006491245.1 | 1e-60 | (Citrus sinensis) | ||||
| STRING | XP_006444875.1 | 1e-60 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G53200.1 | 5e-39 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Ciclev10024111m |
| Entrez Gene | 18049824 |




