![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ciclev10030278m | ||||||||
| Common Name | CICLE_v10030278mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 81aa MW: 9110.33 Da PI: 7.0695 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 45.5 | 1.4e-14 | 3 | 78 | 19 | 97 |
-HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
B3 19 pkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
p +fa ++ + e sk + ++ +sgr+W++ + +++ g+++l+kGW + + +L egD+++F+l+++ + ++++vf
Ciclev10030278m 3 PARFAYQY--VDEDSKSVEVQAPSGRKWSLGI-HWRATGGFFLAKGWAGVSDYVHLTEGDICIFELVKHPDVVFKLHVF 78
77888555..4557889***************.7888899**************************9887765666665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50863 | 12.562 | 1 | 80 | IPR003340 | B3 DNA binding domain |
| CDD | cd10017 | 1.38E-10 | 3 | 78 | No hit | No description |
| SuperFamily | SSF101936 | 1.31E-13 | 3 | 79 | IPR015300 | DNA-binding pseudobarrel domain |
| Gene3D | G3DSA:2.40.330.10 | 1.7E-12 | 3 | 79 | IPR015300 | DNA-binding pseudobarrel domain |
| Pfam | PF02362 | 5.0E-12 | 3 | 77 | IPR003340 | B3 DNA binding domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 81 aa Download sequence Send to blast |
YAPARFAYQY VDEDSKSVEV QAPSGRKWSL GIHWRATGGF FLAKGWAGVS DYVHLTEGDI 60 CIFELVKHPD VVFKLHVFHQ * |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015388635.1 | 5e-51 | B3 domain-containing transcription factor VRN1-like isoform X2 | ||||
| Refseq | XP_024957473.1 | 6e-51 | B3 domain-containing transcription factor VRN1-like isoform X1 | ||||
| TrEMBL | A0A067DLP9 | 6e-51 | A0A067DLP9_CITSI; Uncharacterized protein | ||||
| TrEMBL | V4SIM0 | 2e-52 | V4SIM0_9ROSI; Uncharacterized protein (Fragment) | ||||
| STRING | XP_006487693.1 | 1e-50 | (Citrus sinensis) | ||||
| STRING | XP_006423651.1 | 3e-53 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM23053 | 3 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G18990.1 | 8e-08 | B3 family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Ciclev10030278m |
| Entrez Gene | 18035281 |




