![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ciclev10033415m | ||||||||
| Common Name | CICLE_v10033415mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 127aa MW: 14548.7 Da PI: 9.6436 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 120.5 | 1.6e-37 | 14 | 122 | 1 | 110 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94
lppGfrF+Ptd+elv +yLk kv +++l++ +i++++iyk++PwdLp + e+e yfFs+++ ky++g+r nrat+sgyWkatg dk++ls
Ciclev10033415m 14 LPPGFRFQPTDDELVFQYLKCKVFSSPLPA-PIIPHINIYKYDPWDLPGN---LEQERYFFSNNEAKYPNGNRINRATASGYWKATGLDKQILS 103
79***************************9.88***************54...46799************************************ PP
NAM 95 k...kgelvglkktLvfyk 110
+ ++ l+g+kktLvf +
Ciclev10033415m 104 SsriNQMLMGMKKTLVFTE 122
98777788*********85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 4.45E-40 | 9 | 124 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 39.402 | 14 | 126 | IPR003441 | NAC domain |
| Pfam | PF02365 | 3.6E-18 | 15 | 121 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 127 aa Download sequence Send to blast |
MDNFHFVRDG VTRLPPGFRF QPTDDELVFQ YLKCKVFSSP LPAPIIPHIN IYKYDPWDLP 60 GNLEQERYFF SNNEAKYPNG NRINRATASG YWKATGLDKQ ILSSSRINQM LMGMKKTLVF 120 TEKGPA* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 3e-33 | 14 | 120 | 15 | 120 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006485134.1 | 4e-86 | NAC domain-containing protein 83-like | ||||
| Swissprot | Q9FY93 | 4e-56 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
| TrEMBL | V4SQV0 | 3e-90 | V4SQV0_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006436908.1 | 5e-91 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM22781 | 3 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13180.1 | 1e-58 | NAC domain containing protein 83 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Ciclev10033415m |
| Entrez Gene | 18044992 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




