![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cla005230 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 134aa MW: 15544.2 Da PI: 4.5038 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 142.3 | 1.2e-44 | 12 | 100 | 7 | 95 |
NF-YB 7 flPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
+lPianv+rimkk+lP++akisk+ak t+qec+sefisfvtsea++kc++e+r+t+ngdd++wa+++ G+++y+e ++yl kyre+e+
Cla005230 12 ELPIANVGRIMKKILPQKAKISKEAKTTMQECASEFISFVTSEAAQKCHKENRRTLNGDDICWAFGSYGLDNYAEISEKYLLKYREVER 100
69*************************************************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 6.3E-44 | 8 | 132 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.9E-26 | 12 | 75 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 2.95E-33 | 12 | 129 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 4.1E-14 | 40 | 58 | No hit | No description |
| PRINTS | PR00615 | 4.1E-14 | 59 | 77 | No hit | No description |
| PRINTS | PR00615 | 4.1E-14 | 78 | 96 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 134 aa Download sequence Send to blast |
MGDQHNGDEF VELPIANVGR IMKKILPQKA KISKEAKTTM QECASEFISF VTSEAAQKCH 60 KENRRTLNGD DICWAFGSYG LDNYAEISEK YLLKYREVER IKADQYKCKI TQQLQQGEEE 120 DDDDDDEQEH NNQF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 3e-34 | 13 | 97 | 8 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-34 | 13 | 97 | 8 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681806 | 1e-111 | LN681806.1 Cucumis melo genomic scaffold, anchoredscaffold00025. | |||
| GenBank | LN713256 | 1e-111 | LN713256.1 Cucumis melo genomic chromosome, chr_2. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008451142.1 | 2e-64 | PREDICTED: nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O04027 | 8e-43 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A1S3BRX1 | 5e-63 | A0A1S3BRX1_CUCME; nuclear transcription factor Y subunit B-4 | ||||
| STRING | XP_008451142.1 | 9e-64 | (Cucumis melo) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 3e-45 | nuclear factor Y, subunit B4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




