![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cla007716 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 60aa MW: 6992.85 Da PI: 6.7766 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 36.5 | 1.1e-11 | 14 | 43 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30
+g+W++eEde+l+ +v+q+G +W+ +++
Cla007716 14 KGAWSAEEDEKLKAYVQQHGHCNWRELPKY 43
79***********************99887 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 2.2E-12 | 8 | 51 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 9.922 | 9 | 60 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.0E-9 | 10 | 50 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 5.8E-9 | 14 | 43 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.81E-6 | 16 | 43 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 60 aa Download sequence Send to blast |
MVRAPFYDEN GVKKGAWSAE EDEKLKAYVQ QHGHCNWREL PKYAVFSHKV DYMSCALDSQ |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681792 | 3e-39 | LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034. | |||
| GenBank | LN713255 | 3e-39 | LN713255.1 Cucumis melo genomic chromosome, chr_1. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016901712.1 | 4e-24 | PREDICTED: myb-related protein Myb4-like isoform X1 | ||||
| Refseq | XP_022135702.1 | 2e-23 | transcription factor WER-like | ||||
| TrEMBL | A0A1S4E0E6 | 8e-23 | A0A1S4E0E6_CUCME; myb-related protein Myb4-like isoform X1 | ||||
| STRING | XP_008455365.1 | 4e-22 | (Cucumis melo) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G10280.1 | 1e-15 | myb domain protein 92 | ||||




