PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cla008917

Organism

Citrullus lanatus

Taxonomic ID

3654

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus

Family

bZIP

Protein Properties

Length: 208aa MW: 22863.5 Da PI: 10.585

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cla008917	genome	ICuGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	48.5	1.9e-15	138	188	4	54
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 ++r++r++kNRe+A rsR+RK+a++ eLe +v+ L +eN +L+ + eel+ Cla008917 138 DRRQKRMIKNRESAARSRARKQAYTNELELEVAHLMEENARLRRQQEELRA 188 79*****************************************99999875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	5.9E-15	129	188	No hit	No description
SMART	SM00338	2.0E-13	135	199	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.576	137	187	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.8E-13	139	187	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	3.88E-12	139	188	No hit	No description
CDD	cd14707	1.80E-27	139	193	No hit	No description
PROSITE pattern	PS00036	0	142	157	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009911	Biological Process	positive regulation of flower development
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:2000028	Biological Process	regulation of photoperiodism, flowering
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0043621	Molecular Function	protein self-association

Sequence ? help Back to Top
Protein Sequence Length: 208 aa Download sequence Send to blast
MEEVWKDINL SSLHSRSDHD FSAAAAAPAT PIGLHHHSAA ANFRHIILQD FLSSSTSKLD 60 SSSAATAAAV AAPPPTVLSL NSTRELHFPD NAVAAAHFRH QDPASVSAAF HSPFDQVLGP 120 PPFGKKRVPD SDSNNSGDRR QKRMIKNRES AARSRARKQA YTNELELEVA HLMEENARLR 180 RQQEELRAAA TAQVPRKHRL QRTSTAPF

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the transition to flowering promoted by FT. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681860	3e-79	LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021.
GenBank	LN713260	3e-79	LN713260.1 Cucumis melo genomic chromosome, chr_6.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022923339.1	1e-103	protein FD
Swissprot	Q84JK2	9e-49	FD_ARATH; Protein FD
TrEMBL	A0A1S3BJW5	4e-90	A0A1S3BJW5_CUCME; protein FD
STRING	XP_008448521.1	7e-91	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF3755	32	52

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35900.1	6e-41	bZIP family protein

Publications ? help Back to Top
Ho WW,Weigel D Structural features determining flower-promoting activity of Arabidopsis FLOWERING LOCUS T. Plant Cell, 2014. 26(2): p. 552-64 [PMID:24532592] Ji H, et al. Downregulation of leaf flavin content induces early flowering and photoperiod gene expression in Arabidopsis. BMC Plant Biol., 2014. 14: p. 237 [PMID:25201173] Li L, et al. Expression of turtle riboflavin-binding protein represses mitochondrial electron transport gene expression and promotes flowering in Arabidopsis. BMC Plant Biol., 2014. 14: p. 381 [PMID:25547226] Sussmilch FC, et al. Pea VEGETATIVE2 Is an FD Homolog That Is Essential for Flowering and Compound Inflorescence Development. Plant Cell, 2015. 27(4): p. 1046-60 [PMID:25804541] Khan M, et al. Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006] Andrés F, et al. Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE. Plant Physiol., 2015. 169(3): p. 2187-99 [PMID:26417007] Kawamoto N,Endo M,Araki T Expression of a kinase-dead form of CPK33 involved in florigen complex formation causes delayed flowering. Plant Signal Behav, 2015. 10(12): p. e1086856 [PMID:26440648] Zhang L,Yu H,Lin S,Gao Y Molecular Characterization of FT and FD Homologs from Eriobotrya deflexa Nakai forma koshunensis. Front Plant Sci, 2016. 7: p. 8 [PMID:26834775] Hou CJ,Yang CH Comparative analysis of the pteridophyte Adiantum MFT ortholog reveals the specificity of combined FT/MFT C and N terminal interaction with FD for the regulation of the downstream gene AP1. Plant Mol. Biol., 2016. 91(4-5): p. 563-79 [PMID:27216814] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142] Jang S,Li HY,Kuo ML Ectopic expression of Arabidopsis FD and FD PARALOGUE in rice results in dwarfism with size reduction of spikelets. Sci Rep, 2017. 7: p. 44477 [PMID:28290557]