![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cla009148 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 118aa MW: 13007.7 Da PI: 10.8735 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 101.6 | 4.9e-32 | 52 | 106 | 2 | 56 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ++R +
Cla009148 52 PRMRWTSSLHSQFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMFRAH 106
9****************************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 2.15E-16 | 49 | 106 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.3E-28 | 50 | 106 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 3.8E-24 | 52 | 107 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 6.1E-7 | 53 | 103 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MSTSPTFFSS SSSSSISYSK ISTFTSPPPY LHYQLDSGRS STVARGRSMR APRMRWTSSL 60 HSQFVHAVEL LGGHERATPK SVLELMDVKD LTLAHVKSHL QMFRAHKTTD KPAASPGN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4k_A | 5e-18 | 53 | 104 | 4 | 55 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 5e-18 | 53 | 104 | 4 | 55 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_A | 5e-18 | 53 | 104 | 3 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 5e-18 | 53 | 104 | 3 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 5e-18 | 53 | 104 | 3 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 5e-18 | 53 | 104 | 3 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 5e-18 | 53 | 104 | 4 | 55 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 5e-18 | 53 | 104 | 4 | 55 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 5e-18 | 53 | 104 | 4 | 55 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 5e-18 | 53 | 104 | 4 | 55 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 5e-18 | 53 | 104 | 4 | 55 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 5e-18 | 53 | 104 | 4 | 55 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269|PubMed:11395775, ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928, ECO:0000269|PubMed:18849474, ECO:0000269|PubMed:20179097}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269|PubMed:18849474}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681894 | 3e-50 | LN681894.1 Cucumis melo genomic scaffold, anchoredscaffold00074. | |||
| GenBank | LN713263 | 3e-50 | LN713263.1 Cucumis melo genomic chromosome, chr_9. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008463176.1 | 2e-58 | PREDICTED: probable transcription factor KAN2 | ||||
| Swissprot | Q93WJ9 | 2e-37 | KAN1_ARATH; Transcription repressor KAN1 | ||||
| TrEMBL | A0A1S3CJ01 | 4e-57 | A0A1S3CJ01_CUCME; probable transcription factor KAN2 | ||||
| STRING | XP_008463176.1 | 7e-58 | (Cucumis melo) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1756 | 33 | 91 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G16560.1 | 6e-39 | G2-like family protein | ||||




