PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cla010332

Organism

Citrullus lanatus

Taxonomic ID

3654

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus

Family

MYB

Protein Properties

Length: 311aa MW: 34889.2 Da PI: 7.8278

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cla010332	genome	ICuGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.1	7.2e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd lv +++++G+g+W++++ g+ R+ k+c++rw +yl Cla010332 14 KGPWTPEEDIVLVSYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	49.3	1.1e-15	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T +E++ ++++ ++lG++ W++Ia++++ Rt++++k++w+++l Cla010332 67 RGNFTDQEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112 89******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.4E-23	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.41	9	65	IPR017930	Myb domain
SuperFamily	SSF46689	3.67E-30	11	108	IPR009057	Homeodomain-like
SMART	SM00717	1.5E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.7E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	2.55E-10	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.3E-24	65	116	IPR009057	Homeodomain-like
PROSITE profile	PS51294	20.048	66	116	IPR017930	Myb domain
SMART	SM00717	1.8E-15	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	1.1E-14	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	1.19E-10	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0001666	Biological Process	response to hypoxia
GO:0009617	Biological Process	response to bacterium
GO:0009626	Biological Process	plant-type hypersensitive response
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0042761	Biological Process	very long-chain fatty acid biosynthetic process
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 311 aa Download sequence Send to blast
MGRPPCCDKE GVKKGPWTPE EDIVLVSYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY 60 LRPGIKRGNF TDQEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKVRKVQ 120 VRSNYGDDGF SGTSKQGMAR GQWEKRLQTD IRMARQALWE ALTPQNSTPN FSEILKPSFG 180 CFSYSSTKQS QAQATAYASS TENIAKLLTG WMKNPPKTAD KSTPNGKCGG GGDGDQDFES 240 IFRYECFENG NCNSEMSQSV CNSDNNQAME DGMNCEGLPF SVLEKWLLEE TGGVQPRDCG 300 FNDIGILDEK I

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	6e-26	14	116	4	105	MYB PROTO-ONCOGENE PROTEIN
1h88_C	3e-25	14	116	58	159	MYB PROTO-ONCOGENE PROTEIN
1h89_C	3e-25	14	116	58	159	MYB PROTO-ONCOGENE PROTEIN
1h8a_C	1e-25	14	116	27	128	MYB TRANSFORMING PROTEIN
1mse_C	7e-26	14	116	4	105	C-Myb DNA-Binding Domain
1msf_C	7e-26	14	116	4	105	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269\|PubMed:10571865, ECO:0000269\|PubMed:12119395, ECO:0000269\|PubMed:16730712, ECO:0000269\|PubMed:18326828, ECO:0000269\|PubMed:19170933, ECO:0000269\|PubMed:20696912, ECO:0000269\|PubMed:21917550, ECO:0000269\|PubMed:22814374, ECO:0000269\|PubMed:24587042}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00386	DAP	Transfer from AT3G28910	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269\|PubMed:10571865, ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16730712, ECO:0000269\|PubMed:19170933, ECO:0000269\|PubMed:20696912}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011655993.1	1e-161	PREDICTED: myb-related protein 306-like
Swissprot	Q9SCU7	1e-103	MYB30_ARATH; Transcription factor MYB30
TrEMBL	A0A1S3C9V9	1e-151	A0A1S3C9V9_CUCME; transcription factor MYB30-like
STRING	XP_004173580.1	1e-162	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1016	34	115

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28910.1	1e-97	myb domain protein 30

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kaurilind E,Xu E,Brosché M A genetic framework for H2O2 induced cell death in Arabidopsis thaliana. BMC Genomics, 2015. 16: p. 837 [PMID:26493993] Lee HG,Seo PJ The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96. Nat Commun, 2016. 7: p. 12525 [PMID:27615387] Serrano I, et al. A non canonical subtilase attenuates the transcriptional activation of defence responses in Arabidopsis thaliana. Elife, 2017. [PMID:27685353] Liao C,Zheng Y,Guo Y MYB30 transcription factor regulates oxidative and heat stress responses through ANNEXIN-mediated cytosolic calcium signaling in Arabidopsis. New Phytol., 2017. 216(1): p. 163-177 [PMID:28726305] Lee HG,Kim J,Suh MC,Seo PJ The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems. Plant Cell Physiol., 2017. 58(7): p. 1249-1259 [PMID:28838126] Mabuchi K, et al. MYB30 links ROS signaling, root cell elongation, and plant immune responses. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(20): p. E4710-E4719 [PMID:29712840] Zheng Y,Chen Z,Ma L,Liao C The Ubiquitin E3 Ligase RHA2b Promotes Degradation of MYB30 in Abscisic Acid Signaling. Plant Physiol., 2018. 178(1): p. 428-440 [PMID:30030326]