![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cla010797 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 109aa MW: 13009.5 Da PI: 6.9594 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 49 | 1.3e-15 | 26 | 75 | 5 | 54 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54
+++rr+++NRe+ArrsR RK++ ++eL v L +eN++L+++l++ ++
Cla010797 26 RKQRRMISNRESARRSRMRKQKHLDELWSQVLWLRNENHQLIDKLNQVSE 75
689*****************************************999876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 7.8E-14 | 22 | 86 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.461 | 24 | 75 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 8.13E-14 | 26 | 75 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 3.5E-13 | 26 | 99 | No hit | No description |
| Pfam | PF00170 | 9.5E-14 | 26 | 75 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14702 | 1.04E-15 | 27 | 78 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 29 | 44 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
MNPPSLSSNS TSDEAEDQQL SLINERKQRR MISNRESARR SRMRKQKHLD ELWSQVLWLR 60 NENHQLIDKL NQVSECHDRA LQENAQLKEE ASELRQMLTD FQLHNPYLP |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 38 | 45 | RRSRMRKQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681870 | 1e-161 | LN681870.1 Cucumis melo genomic scaffold, anchoredscaffold00035. | |||
| GenBank | LN713261 | 1e-161 | LN713261.1 Cucumis melo genomic chromosome, chr_7. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016901802.1 | 4e-73 | PREDICTED: basic leucine zipper 43 | ||||
| Swissprot | Q9FMC2 | 2e-40 | BZP43_ARATH; Basic leucine zipper 43 | ||||
| TrEMBL | A0A1S4E0N4 | 8e-72 | A0A1S4E0N4_CUCME; basic leucine zipper 43 | ||||
| STRING | XP_004137148.1 | 4e-72 | (Cucumis sativus) | ||||
| STRING | XP_004154731.1 | 4e-72 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1604 | 33 | 99 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G30530.1 | 9e-51 | basic leucine-zipper 42 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




