![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cla012385 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 138aa MW: 15417.1 Da PI: 10.0775 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 134.1 | 6.7e-42 | 39 | 136 | 17 | 114 |
Whirly 17 tfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtns 114
++ ++sg+l+++r+G+++l + +a++erkydW kkq fals+tev++l++l++++sceffhdp++ +s +G+vrk+l ++ ++dG G+f++ls +++
Cla012385 39 KILLIQSGSLVIDRRGSVMLSFFPAIGERKYDWTKKQLFALSPTEVGTLISLGPRDSCEFFHDPGMLSSTAGQVRKSLTIKAHADGNGYFISLSKDTN 136
556689***************************************************************************************98765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF54447 | 1.73E-31 | 42 | 137 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 1.6E-38 | 42 | 136 | IPR013742 | Plant transcription factor |
| Gene3D | G3DSA:2.30.31.10 | 3.2E-38 | 43 | 136 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006281 | Biological Process | DNA repair | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005739 | Cellular Component | mitochondrion | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 138 aa Download sequence Send to blast |
MKAGVSYLNK LCVRKLVMLD ILWGRILSHL ELAFQIRDKI LLIQSGSLVI DRRGSVMLSF 60 FPAIGERKYD WTKKQLFALS PTEVGTLISL GPRDSCEFFH DPGMLSSTAG QVRKSLTIKA 120 HADGNGYFIS LSKDTNIL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4kop_A | 2e-47 | 43 | 138 | 36 | 131 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_B | 2e-47 | 43 | 138 | 36 | 131 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_C | 2e-47 | 43 | 138 | 36 | 131 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_D | 2e-47 | 43 | 138 | 36 | 131 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that associates with mitochondrial DNA and may play a role in the regulation of the gene expression machinery. Seems also to be required to prevent break-induced DNA rearrangements in the mitochondrial genome. Can bind to melt double-stranded DNA in vivo. {ECO:0000269|PubMed:18423020, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:22762281}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022973421.1 | 3e-55 | single-stranded DNA-binding protein WHY2, mitochondrial | ||||
| Swissprot | Q8VYF7 | 2e-46 | WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
| TrEMBL | A0A0A0KXS2 | 2e-48 | A0A0A0KXS2_CUCSA; Uncharacterized protein | ||||
| STRING | XP_004141520.1 | 4e-49 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF11383 | 33 | 38 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71260.1 | 9e-49 | WHIRLY 2 | ||||




