![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cla014834 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 60aa MW: 6899.98 Da PI: 8.2231 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 25.9 | 2.3e-08 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32
+g+W+ eEd++l++ +++ G +W++ +++
Cla014834 14 KGPWSFEEDQILIKFIQLNGHSNWRALPKKAD 45
79************************999876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 1.87E-8 | 8 | 43 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 6.911 | 9 | 47 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 2.7E-11 | 12 | 46 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 8.3E-7 | 14 | 44 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 5.74E-5 | 16 | 43 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 60 aa Download sequence Send to blast |
MGRAPCCEKV GLKKGPWSFE EDQILIKFIQ LNGHSNWRAL PKKADGQPLQ QDYLEEPTMK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269|PubMed:24415840}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:24415840}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681803 | 4e-63 | LN681803.1 Cucumis melo genomic scaffold, anchoredscaffold00026. | |||
| GenBank | LN713255 | 4e-63 | LN713255.1 Cucumis melo genomic chromosome, chr_1. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004148973.1 | 1e-24 | PREDICTED: myb-related protein Myb4 | ||||
| Refseq | XP_008451250.1 | 1e-24 | PREDICTED: myb-related protein Myb4-like | ||||
| Swissprot | Q9SJX8 | 6e-20 | MYB14_ARATH; Transcription factor MYB14 | ||||
| TrEMBL | A0A0A0KAA1 | 2e-23 | A0A0A0KAA1_CUCSA; Uncharacterized protein | ||||
| TrEMBL | A0A1S3BR10 | 2e-23 | A0A1S3BR10_CUCME; myb-related protein Myb4-like | ||||
| STRING | XP_008451250.1 | 4e-24 | (Cucumis melo) | ||||
| STRING | XP_004167773.1 | 4e-24 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G31180.1 | 3e-22 | myb domain protein 14 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




