PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cla023240

Organism

Citrullus lanatus

Taxonomic ID

3654

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus

Family

G2-like

Protein Properties

Length: 73aa MW: 8500.1 Da PI: 11.3405

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cla023240	genome	ICuGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	87	1.9e-27	20	69	2	51
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 prlrWtpeLH+ Fv+ ve LGG ++AtPk+il++m+vkgL ++h+kSHLQ Cla023240 20 PRLRWTPELHRYFVQTVEILGGRNQATPKRILQMMGVKGLKISHIKSHLQ 69 8************************************************* PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	13.166	16	73	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.6E-24	17	69	IPR009057	Homeodomain-like
SuperFamily	SSF46689	5.55E-14	20	70	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	3.8E-21	20	71	IPR006447	Myb domain, plants
Pfam	PF00249	4.0E-8	21	72	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 73 aa Download sequence Send to blast
MKSCSSERIG VRQYNKSELP RLRWTPELHR YFVQTVEILG GRNQATPKRI LQMMGVKGLK 60 ISHIKSHLQV LLI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4r_A	2e-16	21	69	3	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	2e-16	21	69	3	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	2e-16	21	69	3	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	2e-16	21	69	3	51	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Putative transcription factor.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681865	1e-51	LN681865.1 Cucumis melo genomic scaffold, anchoredscaffold01599.
GenBank	LN713261	1e-51	LN713261.1 Cucumis melo genomic chromosome, chr_7.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022937030.1	7e-45	putative Myb family transcription factor At1g14600
Swissprot	Q700D9	4e-23	MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBL	A0A1S3CS11	7e-42	A0A1S3CS11_CUCME; putative Myb family transcription factor At1g14600
STRING	XP_008466796.1	1e-42	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF9186	28	39

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02060.1	8e-27	G2-like family protein