PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cotton_A_07122_BGI-A2_v1.0

Common Name

F383_16472

Organism

Gossypium arboreum

Taxonomic ID

29729

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

YABBY

Protein Properties

Length: 207aa MW: 23032.3 Da PI: 7.5889

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cotton_A_07122_BGI-A2_v1.0	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	227.1	4.8e-70	10	175	2	170
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlks 84 d+ seq+Cyv+Cn C+t+lavsvP tslfk+vtvrCGhCt+ll vn++ a + hl +++ + ++ l+ ++ Cotton_A_07122_BGI-A2_v1.0 10 DHLPPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLMPSANQFHLPHNFFTPSHNLLEEISNPSPN 92 577899****************************************99999999999999999988765555444443333 PP YABBY 85 nvekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkih 167 ++ ++s + ++ +e+pr+p ++rPPekrqrvPsaynrfik+eiqrika+nPdi+hreafsaaaknWahfP+ih Cotton_A_07122_BGI-A2_v1.0 93 ILLNQGNTSDITLP---TRGVVDELPRPPVINRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHFPHIH 172 33344333333222...3567789999**************************************************** PP YABBY 168 fgl 170 fgl Cotton_A_07122_BGI-A2_v1.0 173 FGL 175 *97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	6.8E-70	14	175	IPR006780	YABBY protein
SuperFamily	SSF47095	9.56E-8	119	168	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	2.5E-4	124	167	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 207 aa Download sequence Send to blast
MSSSSTLSLD HLPPSEQLCY VHCNICDTVL AVSVPCTSLF KTVTVRCGHC TNLLPVNMRG 60 LLMPSANQFH LPHNFFTPSH NLLEEISNPS PNILLNQGNT SDITLPTRGV VDELPRPPVI 120 NRPPEKRQRV PSAYNRFIKD EIQRIKAGNP DITHREAFSA AAKNWAHFPH IHFGLMPDQP 180 AKRTNESEDV LMKDGFFASA NVGVTPY

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269\|PubMed:10323860, ECO:0000269\|PubMed:10331982, ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:11812777, ECO:0000269\|PubMed:12417699, ECO:0000269\|PubMed:19837869, ECO:0000269\|PubMed:9878633, ECO:0000269\|Ref.3, ECO:0000269\|Ref.6}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016665404.1	1e-154	PREDICTED: protein YABBY 4-like isoform X2
Refseq	XP_017634846.1	1e-154	PREDICTED: protein YABBY 4-like isoform X2
Refseq	XP_017634847.1	1e-154	PREDICTED: protein YABBY 4-like isoform X2
Swissprot	O22152	2e-81	YAB1_ARATH; Axial regulator YABBY 1
TrEMBL	A0A0B0PWI9	1e-152	A0A0B0PWI9_GOSAR; Axial regulator YABBY 1-like protein
TrEMBL	A0A1U8HQ51	1e-152	A0A1U8HQ51_GOSHI; protein YABBY 4-like isoform X2
STRING	Gorai.008G236500.1	1e-149	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2217	28	77

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45190.1	9e-84	YABBY family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Lian H,Li X,Liu Z,He Y HYL1 is required for establishment of stamen architecture with four microsporangia in Arabidopsis. J. Exp. Bot., 2013. 64(11): p. 3397-410 [PMID:23918970] Tameshige T, et al. Pattern dynamics in adaxial-abaxial specific gene expression are modulated by a plastid retrograde signal during Arabidopsis thaliana leaf development. PLoS Genet., 2013. 9(7): p. e1003655 [PMID:23935517] Boter M, et al. FILAMENTOUS FLOWER Is a Direct Target of JAZ3 and Modulates Responses to Jasmonate. Plant Cell, 2015. 27(11): p. 3160-74 [PMID:26530088] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Tanaka W,Toriba T,Hirano HY Three TOB1-related YABBY genes are required to maintain proper function of the spikelet and branch meristems in rice. New Phytol., 2017. 215(2): p. 825-839 [PMID:28556940] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187]