PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cotton_A_07719_BGI-A2_v1.0

Common Name

F383_07268

Organism

Gossypium arboreum

Taxonomic ID

29729

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

YABBY

Protein Properties

Length: 216aa MW: 24040.4 Da PI: 7.5318

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cotton_A_07719_BGI-A2_v1.0	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	229.5	8.2e-71	11	177	2	169
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfk.vvtvrCGhCtsllsvnlakasqllaaeshldeslkee..lleelkveeen 81 d+ s ++q+Cyv+CnfC+t+lavsvP +slf+ +v vrCGhCt+llsv+++ +a + hl +s+ + llee ++ Cotton_A_07719_BGI-A2_v1.0 11 DHLSPADQLCYVHCNFCDTVLAVSVPCSSLFNnTVMVRCGHCTNLLSVDMRGLLLPTANQLHLAHSFFTPqnLLEEIRSCAP- 92 688999**********************9549************99999999999999998766335555554332. PP YABBY 82 lksnvekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfP 164 ++ ++++ +++ +v e ee++++p v+rPPekrqrvPsaynrfikeeiqrika+nPdishr+afsaaaknWahfP Cotton_A_07719_BGI-A2_v1.0 93 PNMVMINHPNPNDTVIR---GAAELEEIAKPPVVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHRDAFSAAAKNWAHFP 172 23333333333332222...57899*999********************************************** PP YABBY 165 kihfg 169 +ihfg Cotton_A_07719_BGI-A2_v1.0 173 RIHFG 177 **8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	2.3E-67	15	177	IPR006780	YABBY protein
SuperFamily	SSF47095	6.68E-8	122	172	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	2.2E-4	126	172	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 216 aa Download sequence Send to blast
MSSSSVSFSS DHLSPADQLC YVHCNFCDTV LAVSVPCSSL FNNTVMVRCG HCTNLLSVDM 60 RGLLLPTANQ LHLAHSFFTP QNLLEEIRSC APPNMVMINH PNPNDTVIRG AAELEEIAKP 120 PVVNRPPEKR QRVPSAYNRF IKEEIQRIKA GNPDISHRDA FSAAAKNWAH FPRIHFGQMP 180 DQAVMKMKNN VRQQEGEEAV VKDGFFVPTN VGVSPY

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269\|PubMed:10323860, ECO:0000269\|PubMed:10331982, ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:11812777, ECO:0000269\|PubMed:12417699, ECO:0000269\|PubMed:19837869, ECO:0000269\|PubMed:9878633, ECO:0000269\|Ref.3, ECO:0000269\|Ref.6}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016695371.1	1e-161	PREDICTED: axial regulator YABBY 1-like
Refseq	XP_017614212.1	1e-161	PREDICTED: axial regulator YABBY 1-like
Swissprot	O22152	7e-84	YAB1_ARATH; Axial regulator YABBY 1
TrEMBL	A0A0B0P5Z7	1e-160	A0A0B0P5Z7_GOSAR; Axial regulator YABBY 1-like protein
TrEMBL	A0A1U8JYL7	1e-160	A0A1U8JYL7_GOSHI; axial regulator YABBY 1-like
TrEMBL	A0A2P5XPH9	1e-160	A0A2P5XPH9_GOSBA; Uncharacterized protein
STRING	Gorai.007G089700.1	1e-160	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2217	28	77

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45190.1	9e-83	YABBY family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Lian H,Li X,Liu Z,He Y HYL1 is required for establishment of stamen architecture with four microsporangia in Arabidopsis. J. Exp. Bot., 2013. 64(11): p. 3397-410 [PMID:23918970] Tameshige T, et al. Pattern dynamics in adaxial-abaxial specific gene expression are modulated by a plastid retrograde signal during Arabidopsis thaliana leaf development. PLoS Genet., 2013. 9(7): p. e1003655 [PMID:23935517] Boter M, et al. FILAMENTOUS FLOWER Is a Direct Target of JAZ3 and Modulates Responses to Jasmonate. Plant Cell, 2015. 27(11): p. 3160-74 [PMID:26530088] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Tanaka W,Toriba T,Hirano HY Three TOB1-related YABBY genes are required to maintain proper function of the spikelet and branch meristems in rice. New Phytol., 2017. 215(2): p. 825-839 [PMID:28556940] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187]