PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cotton_A_14821_BGI-A2_v1.0

Organism

Gossypium arboreum

Taxonomic ID

29729

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB_related

Protein Properties

Length: 91aa MW: 10100.4 Da PI: 7.6163

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cotton_A_14821_BGI-A2_v1.0	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	27.8	6e-09	48	83	13	48
HHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 13 vdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +++v+ +G g+W+ + + g++ +k+c++rw ++l Cotton_A_14821_BGI-A2_v1.0 48 AEYVRSHGEGNWNVVQKNTGLTHRGKSCRLRWVNHL 83 799******************************996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	2.85E-7	41	84	IPR009057	Homeodomain-like
CDD	cd00167	1.15E-5	45	83	No hit	No description
Pfam	PF00249	6.2E-8	47	83	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.5E-7	47	83	IPR009057	Homeodomain-like
PROSITE profile	PS50090	6.133	47	83	IPR017877	Myb-like domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MMMMGGNNQF TTQNEGGGFL GSNGMDNGGV DIGREGEIVL EKGLWTVAEY VRSHGEGNWN 60 VVQKNTGLTH RGKSCRLRWV NHLLFVKDTL F

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB97 and MYB101, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250\|UniProtKB:O80883, ECO:0000269\|PubMed:23791732, ECO:0000269\|PubMed:24278028}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Accumulates in pollen tube 4 hours after pollen germination. {ECO:0000269\|PubMed:19714218}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007020787.2	1e-28	PREDICTED: myb-like protein A
Refseq	XP_021288042.1	1e-28	transcription factor MYB97-like
Swissprot	Q94FL7	1e-17	MY120_ARATH; Transcription factor MYB120
TrEMBL	A0A2P5YTN0	1e-38	A0A2P5YTN0_GOSBA; Uncharacterized protein
STRING	EOY12312	1e-28	(Theobroma cacao)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G55020.1	4e-20	myb domain protein 120

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]