![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cotton_A_17221_BGI-A2_v1.0 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 182aa MW: 20546.5 Da PI: 9.8773 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 87.3 | 8.6e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n+ rqvtfskRr g++KKA+ELS+LCdae+a+++fs+ gkl+eyss
Cotton_A_17221_BGI-A2_v1.0 9 KKIDNTAARQVTFSKRRRGLFKKAHELSTLCDAEIALLVFSNAGKLFEYSS 59
68***********************************************96 PP
| |||||||
| 2 | K-box | 28.2 | 7.9e-11 | 92 | 143 | 19 | 70 |
K-box 19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70
a L kei + +e+R+l Ge+L+ L+l+eL++Le+ Le +l+++ ++K+
Cotton_A_17221_BGI-A2_v1.0 92 STCAMLGKEIAEKTKELRQLRGEELQGLDLEELKHLEKLLEGGLNRVTQTKM 143
5566777888888899*******************************99996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 7.8E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 29.604 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.27E-29 | 2 | 70 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 5.41E-39 | 3 | 68 | No hit | No description |
| PRINTS | PR00404 | 2.3E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.6E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 7.17 | 87 | 182 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 7.0E-8 | 92 | 143 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 182 aa Download sequence Send to blast |
MTRQKIQIKK IDNTAARQVT FSKRRRGLFK KAHELSTLCD AEIALLVFSN AGKLFEYSST 60 STRQVIERRN LQSERIDRLD PISTLELQLQ SSTCAMLGKE IAEKTKELRQ LRGEELQGLD 120 LEELKHLEKL LEGGLNRVTQ TKMGNSPHVV QPTVAQQGLG QPSECNGHAW RSYSSDISLR 180 LG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 3e-19 | 1 | 74 | 1 | 74 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 3e-19 | 1 | 74 | 1 | 74 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 3e-19 | 1 | 74 | 1 | 74 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 3e-19 | 1 | 74 | 1 | 74 | Myocyte-specific enhancer factor 2B |
| 5f28_C | 4e-19 | 1 | 66 | 1 | 66 | MEF2C |
| 5f28_D | 4e-19 | 1 | 66 | 1 | 66 | MEF2C |
| 6byy_A | 3e-19 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
| 6byy_B | 3e-19 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
| 6byy_C | 3e-19 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
| 6byy_D | 3e-19 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
| 6bz1_A | 3e-19 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
| 6bz1_B | 3e-19 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
| 6bz1_C | 3e-19 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
| 6bz1_D | 3e-19 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
| 6c9l_A | 3e-19 | 1 | 74 | 1 | 74 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 3e-19 | 1 | 74 | 1 | 74 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 3e-19 | 1 | 74 | 1 | 74 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 3e-19 | 1 | 74 | 1 | 74 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 3e-19 | 1 | 74 | 1 | 74 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 3e-19 | 1 | 74 | 1 | 74 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KC155651 | 0.0 | KC155651.1 Gossypium hirsutum MADS box protein MADS56 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017618862.1 | 1e-125 | PREDICTED: MADS-box protein SVP-like | ||||
| Swissprot | Q9FVC1 | 5e-57 | SVP_ARATH; MADS-box protein SVP | ||||
| TrEMBL | A0A2P5WAD3 | 1e-123 | A0A2P5WAD3_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.013G055700.1 | 1e-119 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM22221 | 4 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G22540.1 | 1e-41 | MIKC_MADS family protein | ||||




