PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cotton_A_17221_BGI-A2_v1.0

Organism

Gossypium arboreum

Taxonomic ID

29729

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MIKC_MADS

Protein Properties

Length: 182aa MW: 20546.5 Da PI: 9.8773

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cotton_A_17221_BGI-A2_v1.0	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	87.3	8.6e-28	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n+ rqvtfskRr g++KKA+ELS+LCdae+a+++fs+ gkl+eyss Cotton_A_17221_BGI-A2_v1.0 9 KKIDNTAARQVTFSKRRRGLFKKAHELSTLCDAEIALLVFSNAGKLFEYSS 59 68***********************************************96 PP
2	K-box	28.2	7.9e-11	92	143	19	70
K-box 19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 a L kei + +e+R+l Ge+L+ L+l+eL++Le+ Le +l+++ ++K+ Cotton_A_17221_BGI-A2_v1.0 92 STCAMLGKEIAEKTKELRQLRGEELQGLDLEELKHLEKLLEGGLNRVTQTKM 143 5566777888888899*******************************99996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	7.8E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.604	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.27E-29	2	70	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.41E-39	3	68	No hit	No description
PRINTS	PR00404	2.3E-27	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.6E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.3E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.3E-27	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	7.17	87	182	IPR002487	Transcription factor, K-box
Pfam	PF01486	7.0E-8	92	143	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 182 aa Download sequence Send to blast
MTRQKIQIKK IDNTAARQVT FSKRRRGLFK KAHELSTLCD AEIALLVFSN AGKLFEYSST 60 STRQVIERRN LQSERIDRLD PISTLELQLQ SSTCAMLGKE IAEKTKELRQ LRGEELQGLD 120 LEELKHLEKL LEGGLNRVTQ TKMGNSPHVV QPTVAQQGLG QPSECNGHAW RSYSSDISLR 180 LG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	3e-19	1	74	1	74	Myocyte-specific enhancer factor 2B
1tqe_Q	3e-19	1	74	1	74	Myocyte-specific enhancer factor 2B
1tqe_R	3e-19	1	74	1	74	Myocyte-specific enhancer factor 2B
1tqe_S	3e-19	1	74	1	74	Myocyte-specific enhancer factor 2B
5f28_C	4e-19	1	66	1	66	MEF2C
5f28_D	4e-19	1	66	1	66	MEF2C
6byy_A	3e-19	1	74	1	74	MEF2 CHIMERA
6byy_B	3e-19	1	74	1	74	MEF2 CHIMERA
6byy_C	3e-19	1	74	1	74	MEF2 CHIMERA
6byy_D	3e-19	1	74	1	74	MEF2 CHIMERA
6bz1_A	3e-19	1	74	1	74	MEF2 CHIMERA
6bz1_B	3e-19	1	74	1	74	MEF2 CHIMERA
6bz1_C	3e-19	1	74	1	74	MEF2 CHIMERA
6bz1_D	3e-19	1	74	1	74	MEF2 CHIMERA
6c9l_A	3e-19	1	74	1	74	Myocyte-specific enhancer factor 2B
6c9l_B	3e-19	1	74	1	74	Myocyte-specific enhancer factor 2B
6c9l_C	3e-19	1	74	1	74	Myocyte-specific enhancer factor 2B
6c9l_D	3e-19	1	74	1	74	Myocyte-specific enhancer factor 2B
6c9l_E	3e-19	1	74	1	74	Myocyte-specific enhancer factor 2B
6c9l_F	3e-19	1	74	1	74	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269\|PubMed:16679456, ECO:0000269\|PubMed:18694458, ECO:0000269\|PubMed:19656343, ECO:0000269\|PubMed:25132385}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269\|PubMed:15659097, ECO:0000269\|PubMed:17428825, ECO:0000269\|PubMed:18694458}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC155651	0.0	KC155651.1 Gossypium hirsutum MADS box protein MADS56 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017618862.1	1e-125	PREDICTED: MADS-box protein SVP-like
Swissprot	Q9FVC1	5e-57	SVP_ARATH; MADS-box protein SVP
TrEMBL	A0A2P5WAD3	1e-123	A0A2P5WAD3_GOSBA; Uncharacterized protein
STRING	Gorai.013G055700.1	1e-119	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM22221	4	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G22540.1	1e-41	MIKC_MADS family protein

Publications ? help Back to Top
Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae). PLoS ONE, 2013. 8(6): p. e67243 [PMID:23840638] Jaudal M, et al. Overexpression of Medicago SVP genes causes floral defects and delayed flowering in Arabidopsis but only affects floral development in Medicago. J. Exp. Bot., 2014. 65(2): p. 429-42 [PMID:24249713] Müller-Xing R,Clarenz O,Pokorny L,Goodrich J,Schubert D Polycomb-Group Proteins and FLOWERING LOCUS T Maintain Commitment to Flowering in Arabidopsis thaliana. Plant Cell, 2014. 26(6): p. 2457-2471 [PMID:24920331] Hwan Lee J,Sook Chung K,Kim SK,Ahn JH Post-translational regulation of SHORT VEGETATIVE PHASE as a major mechanism for thermoregulation of flowering. Plant Signal Behav, 2014. 9(4): p. e28193 [PMID:25764420] Chen Z, et al. Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar. Transgenic Res., 2015. 24(4): p. 705-15 [PMID:25820621] Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch]. BMC Plant Biol., 2015. 15: p. 41 [PMID:25848674] Müller-Xing R,Schubert D,Goodrich J Non-inductive conditions expose the cryptic bract of flower phytomeres in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(4): p. e1010868 [PMID:25924005] Marín-González E, et al. SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures. Plant Physiol., 2015. 169(2): p. 1214-24 [PMID:26243615] Bechtold U, et al. Time-Series Transcriptomics Reveals That AGAMOUS-LIKE22 Affects Primary Metabolism and Developmental Processes in Drought-Stressed Arabidopsis. Plant Cell, 2016. 28(2): p. 345-66 [PMID:26842464] Fernández V,Takahashi Y,Le Gourrierec J,Coupland G Photoperiodic and thermosensory pathways interact through CONSTANS to promote flowering at high temperature under short days. Plant J., 2016. 86(5): p. 426-40 [PMID:27117775] Wilson DC,Kempthorne CJ,Carella P,Liscombe DK,Cameron RK Age-Related Resistance in Arabidopsis thaliana Involves the MADS-Domain Transcription Factor SHORT VEGETATIVE PHASE and Direct Action of Salicylic Acid on Pseudomonas syringae. Mol. Plant Microbe Interact., 2017. 30(11): p. 919-929 [PMID:28812948] Zou YP, et al. Adaptation of Arabidopsis thaliana to the Yangtze River basin. Genome Biol., 2017. 18(1): p. 239 [PMID:29284515] Richter R, et al. Floral regulators FLC and SOC1 directly regulate expression of the B3-type transcription factor TARGET OF FLC AND SVP 1 at the Arabidopsis shoot apex via antagonistic chromatin modifications. PLoS Genet., 2019. 15(4): p. e1008065 [PMID:30946745]