![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cotton_A_18789_BGI-A2_v1.0 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 135aa MW: 15394.3 Da PI: 4.8194 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 173.3 | 2.5e-54 | 17 | 113 | 2 | 98 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84
reqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvtseasdkc++e+rkting+d++walatlGf+dy++pl+
Cotton_A_18789_BGI-A2_v1.0 17 REQDRLLPIANVGRIMKQMLPPNAKISKEAKETMQECVSEFISFVTSEASDKCRKERRKTINGEDICWALATLGFDDYAAPLR 99
89********************************************************************************* PP
NF-YB 85 vylkkyrelegekk 98
yl+kyre+eg++k
Cotton_A_18789_BGI-A2_v1.0 100 RYLNKYREVEGDNK 113
***********975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 9.2E-53 | 12 | 120 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.66E-40 | 19 | 118 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.5E-28 | 22 | 86 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 4.1E-19 | 50 | 68 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 53 | 69 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 4.1E-19 | 69 | 87 | No hit | No description |
| PRINTS | PR00615 | 4.1E-19 | 88 | 106 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 135 aa Download sequence Send to blast |
MAENVGASGS NDDDGFREQD RLLPIANVGR IMKQMLPPNA KISKEAKETM QECVSEFISF 60 VTSEASDKCR KERRKTINGE DICWALATLG FDDYAAPLRR YLNKYREVEG DNKAANQDKV 120 NNDSYIYIYI YICSF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 8e-44 | 16 | 107 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 8e-44 | 16 | 107 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JX579563 | 3e-50 | JX579563.1 Gossypium hirsutum clone NBRI_GE11831 microsatellite sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016676646.1 | 2e-86 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
| Refseq | XP_017647656.1 | 3e-86 | PREDICTED: nuclear transcription factor Y subunit B-1-like | ||||
| Swissprot | O82248 | 8e-54 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A2P5YIH2 | 1e-86 | A0A2P5YIH2_GOSBA; Uncharacterized protein | ||||
| STRING | EOY06479 | 6e-74 | (Theobroma cacao) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 1e-56 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




