![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cotton_A_19336_BGI-A2_v1.0 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 145aa MW: 17123.4 Da PI: 8.9704 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 183.3 | 5.9e-57 | 5 | 134 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratks 80
+ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++ ++ e++ewyfFs++dkky+tg+r+nrat +
Cotton_A_19336_BGI-A2_v1.0 5 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQErcRIGYeEQSEWYFFSHKDKKYPTGTRTNRATMA 86
69****************************.9***************953433332566************************ PP
NAM 81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
g+Wkatg+dk+v++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle
Cotton_A_19336_BGI-A2_v1.0 87 GFWKATGRDKAVYD-KSKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 134
**************.999*****************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 5.1E-58 | 3 | 138 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 55.48 | 5 | 145 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.8E-30 | 6 | 133 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 145 aa Download sequence Send to blast |
MESCVPPGFR FHPTDEELVG YYLRKKVASQ KIDLDVIRDI DLYRIEPWDL QERCRIGYEE 60 QSEWYFFSHK DKKYPTGTRT NRATMAGFWK ATGRDKAVYD KSKLIGMRKT LVFYKGRAPN 120 GQKTDWIMHE YRLESDENGP PQAST |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 3e-51 | 2 | 133 | 12 | 140 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KC847207 | 0.0 | KC847207.1 Gossypium hirsutum NAC domain protein NAC30 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011025923.1 | 1e-104 | PREDICTED: NAC domain-containing protein 7-like isoform X1 | ||||
| Refseq | XP_012491574.1 | 1e-104 | PREDICTED: NAC domain-containing protein 7-like | ||||
| Refseq | XP_012491575.1 | 1e-104 | PREDICTED: NAC domain-containing protein 7-like | ||||
| Refseq | XP_012491576.1 | 1e-104 | PREDICTED: NAC domain-containing protein 7-like | ||||
| Refseq | XP_016696620.1 | 1e-104 | PREDICTED: NAC domain-containing protein 37-like | ||||
| Refseq | XP_016696621.1 | 1e-104 | PREDICTED: NAC domain-containing protein 37-like | ||||
| Refseq | XP_017629786.1 | 1e-104 | PREDICTED: NAC domain-containing protein 37-like | ||||
| Refseq | XP_017629787.1 | 1e-104 | PREDICTED: NAC domain-containing protein 37-like | ||||
| Refseq | XP_017629788.1 | 1e-104 | PREDICTED: NAC domain-containing protein 37-like | ||||
| Refseq | XP_021908313.1 | 1e-105 | NAC domain-containing protein 37-like | ||||
| Swissprot | Q9SL41 | 2e-99 | NAC37_ARATH; NAC domain-containing protein 37 | ||||
| TrEMBL | A0A1R3IPU6 | 1e-104 | A0A1R3IPU6_9ROSI; No apical meristem (NAM) protein | ||||
| TrEMBL | A0A218XVB2 | 1e-104 | A0A218XVB2_PUNGR; Uncharacterized protein | ||||
| STRING | Gorai.007G196400.1 | 1e-103 | (Gossypium raimondii) | ||||
| STRING | evm.model.supercontig_6.226 | 1e-104 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3686 | 26 | 61 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G18060.1 | 1e-102 | vascular related NAC-domain protein 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




