![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cotton_A_21066_BGI-A2_v1.0 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 177aa MW: 19057.2 Da PI: 6.2666 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 178.8 | 4.8e-56 | 30 | 124 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyvepl 83
vreqdr+lPian+srimkk+lP+n+ki+kdak+tvqecvsefisf+tseasdkcq+ekrktingddllwa+atlGfedy+epl
Cotton_A_21066_BGI-A2_v1.0 30 VREQDRYLPIANISRIMKKALPSNGKIAKDAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPL 112
69********************************************************************************* PP
NF-YB 84 kvylkkyreleg 95
k+yl++yre ++
Cotton_A_21066_BGI-A2_v1.0 113 KIYLARYREGDT 124
********9665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.5E-53 | 26 | 126 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 9.47E-40 | 33 | 134 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.1E-28 | 36 | 100 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 3.5E-21 | 64 | 82 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 67 | 83 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 3.5E-21 | 83 | 101 | No hit | No description |
| PRINTS | PR00615 | 3.5E-21 | 102 | 120 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 177 aa Download sequence Send to blast |
MADGMGGGPT SPAGGSHESG GEHSSPQSTV REQDRYLPIA NISRIMKKAL PSNGKIAKDA 60 KDTVQECVSE FISFITSEAS DKCQKEKRKT INGDDLLWAM ATLGFEDYIE PLKIYLARYR 120 EGDTKGSARG GDGSFKRDAA GALPAQNPQF SIQGSLNYIN SQAQGQHMII PSMQGNE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 3e-48 | 29 | 121 | 1 | 93 | NF-YB |
| 4awl_B | 2e-48 | 29 | 121 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-48 | 29 | 121 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012447849.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_012447850.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_012447851.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_016685850.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_016685851.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_016685852.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_016685853.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_016748326.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_016748327.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_016748328.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_017607610.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Swissprot | Q8VYK4 | 7e-77 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A0D2UWW5 | 1e-129 | A0A0D2UWW5_GOSRA; Uncharacterized protein | ||||
| STRING | Gorai.009G315600.1 | 1e-127 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1480 | 27 | 94 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 6e-74 | nuclear factor Y, subunit B8 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




