![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cotton_A_26079_BGI-A2_v1.0 | ||||||||
| Common Name | F383_09897 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 160aa MW: 17917.1 Da PI: 10.0116 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 106 | 3.2e-33 | 65 | 121 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep++VNaKQy++Il+RRq+Rak+e+e+kl +ksrkpylheSRh hAlrR+RgsgGrF
Cotton_A_26079_BGI-A2_v1.0 65 EEPVFVNAKQYHGILRRRQSRAKAESENKL-AKSRKPYLHESRHLHALRRARGSGGRF 121
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 1.4E-36 | 63 | 124 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 38.039 | 64 | 124 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 2.2E-28 | 66 | 121 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 5.6E-24 | 67 | 89 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 69 | 89 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 5.6E-24 | 98 | 121 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 160 aa Download sequence Send to blast |
MPYTTPQHAV APAAYPYPDP YYRSIFAPYD AQSYPPQPYG GQPMVHLQLM GIQQAGVPLP 60 SDAVEEPVFV NAKQYHGILR RRQSRAKAES ENKLAKSRKP YLHESRHLHA LRRARGSGGR 120 FLNSKKNENK QNEAAPSDKS QSNINLNSDK NELASTEGKC |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 4e-22 | 64 | 129 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM422775 | 1e-62 | AM422775.1 Antirrhinum majus mRNA for YA6 (nf-YA gene). | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016749806.1 | 1e-116 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Refseq | XP_016749808.1 | 1e-116 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Refseq | XP_017641532.1 | 1e-116 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Refseq | XP_017641533.1 | 1e-116 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Refseq | XP_017642281.1 | 1e-116 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Refseq | XP_017642282.1 | 1e-116 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Swissprot | Q84JP1 | 6e-65 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | A0A0B0NSG0 | 1e-114 | A0A0B0NSG0_GOSAR; Nuclear transcription factor Y subunit A-7-like protein | ||||
| TrEMBL | A0A1U8PF16 | 1e-114 | A0A1U8PF16_GOSHI; nuclear transcription factor Y subunit A-7-like | ||||
| TrEMBL | A0A2P5XWA8 | 1e-114 | A0A2P5XWA8_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.009G115000.1 | 1e-115 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4168 | 27 | 56 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.2 | 4e-53 | nuclear factor Y, subunit A7 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




