![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cotton_A_31060_BGI-A2_v1.0 | ||||||||
| Common Name | F383_25983 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 75aa MW: 8579.47 Da PI: 4.1069 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 36.2 | 1.4e-11 | 20 | 61 | 1 | 44 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
++ ++++E+ l+++ +++ G + W++Ia +++ gRt+++++ +w
Cotton_A_31060_BGI-A2_v1.0 20 KLDFSEDEETLIIRMFNLVGER-WSLIAGRIP-GRTAEEIQKYW 61
5789******************.*********.*********** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50090 | 7.48 | 15 | 65 | IPR017877 | Myb-like domain |
| SMART | SM00717 | 5.3E-8 | 19 | 67 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.18E-9 | 22 | 65 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 2.2E-10 | 22 | 61 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 4.90E-9 | 23 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-13 | 23 | 63 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 75 aa Download sequence Send to blast |
MADMDGSSVD SKEESSEDSK LDFSEDEETL IIRMFNLVGE RWSLIAGRIP GRTAEEIQKY 60 WASRFSYNNP MPNLS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JX964005 | 1e-32 | JX964005.1 Gossypium hirsutum clone NBRI_TRANS-274 microsatellite sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017635393.1 | 7e-49 | PREDICTED: MYB-like transcription factor ETC1 | ||||
| Swissprot | Q9LNI5 | 4e-15 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
| TrEMBL | A0A0B0MQ85 | 5e-47 | A0A0B0MQ85_GOSAR; Transcription factor CPC-like protein | ||||
| TrEMBL | A0A2P5XBK1 | 2e-46 | A0A2P5XBK1_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.008G172400.1 | 7e-46 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G01380.1 | 4e-15 | MYB_related family protein | ||||




