PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cotton_A_34222_BGI-A2_v1.0

Organism

Gossypium arboreum

Taxonomic ID

29729

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NAC

Protein Properties

Length: 78aa MW: 9527.91 Da PI: 6.8046

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cotton_A_34222_BGI-A2_v1.0	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	62.2	1.6e-19	19	68	2	52
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvk 52 pGfrFhPtdeelv +yL++kve+k++++ e ik++diy+++PwdLp+ ++ Cotton_A_34222_BGI-A2_v1.0 19 LPGFRFHPTDEELVGFYLRRKVEKKPISI-ELIKQIDIYQYDPWDLPNWLY 68 59*************************.89************96443 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	19.11	18	78	IPR003441	NAC domain
SuperFamily	SSF101941	1.18E-18	18	68	IPR003441	NAC domain
Pfam	PF02365	4.9E-9	20	61	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
MEDSIDDNKK KRNGEEIKLP GFRFHPTDEE LVGFYLRRKV EKKPISIELI KQIDIYQYDP 60 WDLPNWLYDT RKLHHIIT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	5e-13	9	64	4	61	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Promotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269\|PubMed:19081078}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269\|PubMed:19081078}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017610401.1	7e-39	PREDICTED: protein FEZ-like isoform X3
Refseq	XP_017629011.1	3e-39	PREDICTED: transcription factor JUNGBRUNNEN 1-like
Swissprot	Q9ZVH0	2e-22	FEZ_ARATH; Protein FEZ
TrEMBL	A0A1U8KNI3	2e-37	A0A1U8KNI3_GOSHI; protein FEZ isoform X4
TrEMBL	A0A1U8KTF0	2e-37	A0A1U8KTF0_GOSHI; transcription factor JUNGBRUNNEN 1 isoform X3
STRING	Gorai.001G091900.1	8e-37	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7967	13	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G26870.1	5e-25	NAC family protein

Publications ? help Back to Top
Bennett T,van den Toorn A,Willemsen V,Scheres B Precise control of plant stem cell activity through parallel regulatory inputs. Development, 2014. 141(21): p. 4055-64 [PMID:25256342]