![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cotton_A_38757_BGI-A2_v1.0 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 147aa MW: 17299.9 Da PI: 10.3459 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 54.7 | 2.3e-17 | 41 | 85 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
r +WT+eE++++++a +++G g W+ I +++g ++++ q++s+ qk+
Cotton_A_38757_BGI-A2_v1.0 41 REKWTEEEHQRFLEALRLYGRG-WRQIEEHVG-TKSAVQIRSHAQKF 85
789*******************.*********.************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:3.30.170.10 | 1.3E-14 | 1 | 40 | IPR000789 | Cyclin-dependent kinase, regulatory subunit |
| SuperFamily | SSF55637 | 1.83E-14 | 2 | 41 | IPR000789 | Cyclin-dependent kinase, regulatory subunit |
| SMART | SM01084 | 3.6E-10 | 3 | 54 | IPR000789 | Cyclin-dependent kinase, regulatory subunit |
| PRINTS | PR00296 | 2.0E-9 | 3 | 17 | IPR000789 | Cyclin-dependent kinase, regulatory subunit |
| Pfam | PF01111 | 5.9E-14 | 4 | 40 | IPR000789 | Cyclin-dependent kinase, regulatory subunit |
| PROSITE pattern | PS00944 | 0 | 6 | 24 | IPR000789 | Cyclin-dependent kinase, regulatory subunit |
| PRINTS | PR00296 | 2.0E-9 | 18 | 32 | IPR000789 | Cyclin-dependent kinase, regulatory subunit |
| PROSITE profile | PS51294 | 19.28 | 36 | 90 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 8.22E-16 | 38 | 89 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.1E-16 | 39 | 88 | IPR006447 | Myb domain, plants |
| SMART | SM00717 | 1.9E-12 | 40 | 88 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.7E-15 | 41 | 84 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.1E-9 | 41 | 81 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.12E-10 | 43 | 86 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007049 | Biological Process | cell cycle | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0016538 | Molecular Function | cyclin-dependent protein serine/threonine kinase regulator activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 147 aa Download sequence Send to blast |
MGQIQYSEKY FDDTYEYRHV VLPPEVAKLL PKNRLLSENQ REKWTEEEHQ RFLEALRLYG 60 RGWRQIEEHV GTKSAVQIRS HAQKFFSKVV RESNGGFDGS IKPVVIPPPH LKRKPVHPYP 120 RKFVNLVKGI FISRIFISSL INLNNQC |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Morning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012469152.1 | 3e-47 | PREDICTED: protein REVEILLE 7-like isoform X2 | ||||
| Refseq | XP_012469158.1 | 3e-47 | PREDICTED: protein REVEILLE 7-like isoform X2 | ||||
| Refseq | XP_016744075.1 | 2e-47 | PREDICTED: protein REVEILLE 7-like isoform X3 | ||||
| Refseq | XP_016744076.1 | 2e-47 | PREDICTED: protein REVEILLE 7-like isoform X3 | ||||
| Refseq | XP_016744077.1 | 2e-47 | PREDICTED: protein REVEILLE 7-like isoform X3 | ||||
| Refseq | XP_016744078.1 | 2e-47 | PREDICTED: protein REVEILLE 7-like isoform X3 | ||||
| Swissprot | F4KGY6 | 9e-35 | RVE1_ARATH; Protein REVEILLE 1 | ||||
| TrEMBL | A0A2P5YMN5 | 3e-93 | A0A2P5YMN5_GOSBA; Cyclin-dependent kinases regulatory subunit | ||||
| STRING | Gorai.001G069700.1 | 2e-46 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM6356 | 26 | 44 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G17300.1 | 6e-37 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




