PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa02164s010.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

Protein Properties

Length: 178aa MW: 19029.3 Da PI: 9.8477

Description

B3 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa02164s010.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	B3	41.2	3.1e-13	78	122	53	99
EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS B3 53 rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 r +++r++lt+GW++Fv+ ++L +gD+vvF+ ++s e++++v+r+ Csa02164s010.1 78 RTTPRRHLLTTGWSKFVNNKKLIAGDSVVFM--RKSADEMFIGVRRA 122 678899***********************..44788899*997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101936	1.57E-10	78	123	IPR015300	DNA-binding pseudobarrel domain
Gene3D	G3DSA:2.40.330.10	8.7E-12	78	122	IPR015300	DNA-binding pseudobarrel domain
Pfam	PF02362	2.5E-10	78	122	IPR003340	B3 DNA binding domain
PROSITE profile	PS50863	8.995	83	123	IPR003340	B3 DNA binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 178 aa Download sequence Send to blast
NSSQPPRFLT RYIGLVPSVS CDTPSNVAAL FASFSMTVTD QPSMADNYQF DLGGSDAKAT 60 PVVDCLRHLS TVSSSSSRTT PRRHLLTTGW SKFVNNKKLI AGDSVVFMRK SADEMFIGVR 120 RAPISSNIGG TSFYGGDEYC SYYQSSGGVA KEDDGSAKKG FRRTGKGKLT AEATALR*

Functional Description ? help Back to Top
Source	Description
UniProt	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269\|PubMed:12036261}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa02164s010.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC007143	1e-163	AC007143.5 Arabidopsis thaliana chromosome 2 BAC T17H1 genomic sequence, complete sequence.
GenBank	AC007730	1e-163	AC007730.3 Arabidopsis thaliana chromosome 2 BAC T5M2 genomic sequence, complete sequence.
GenBank	AK230014	1e-163	AK230014.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL22-53-A06.
GenBank	CP002685	1e-163	CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBank	JF729200	1e-163	JF729200.1 Arabidopsis thaliana ecotype C24 mitochondrion, complete genome.
GenBank	JF729201	1e-163	JF729201.1 Arabidopsis thaliana ecotype Col-0 mitochondrion, complete genome.
GenBank	JF729202	1e-163	JF729202.1 Arabidopsis thaliana ecotype Landsberg erecta mitochondrion, complete genome.
GenBank	Y08501	1e-163	Y08501.2 Arabidopsis thaliana mitochondrial genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006302016.2	2e-45	auxin response factor 17
Swissprot	Q84WU6	6e-37	ARFQ_ARATH; Auxin response factor 17
TrEMBL	A0A178U5R5	1e-105	A0A178U5R5_ARATH; Auxin response factor
STRING	Cagra.24523s0002.1.p	1e-65	(Capsella grandiflora)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM580	27	130

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G77850.1	9e-32	auxin response factor 17

Publications ? help Back to Top
Shi ZH, et al. Overexpression of AtTTP affects ARF17 expression and leads to male sterility in Arabidopsis. PLoS ONE, 2015. 10(3): p. e0117317 [PMID:25822980] de Lucas M, et al. Transcriptional Regulation of Arabidopsis Polycomb Repressive Complex 2 Coordinates Cell-Type Proliferation and Differentiation. Plant Cell, 2016. 28(10): p. 2616-2631 [PMID:27650334] Wójcikowska B,Gaj MD Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis. Plant Cell Rep., 2017. 36(6): p. 843-858 [PMID:28255787] Wang B, et al. Fine regulation of ARF17 for anther development and pollen formation. BMC Plant Biol., 2017. 17(1): p. 243 [PMID:29258431] Wójcik AM,Nodine MD,Gaj MD miR160 and miR166/165 Contribute to the LEC2-Mediated Auxin Response Involved in the Somatic Embryogenesis Induction in Arabidopsis. Front Plant Sci, 2017. 8: p. 2024 [PMID:29321785] Lin JS, et al. MicroRNA160 Modulates Plant Development and Heat Shock Protein Gene Expression to Mediate Heat Tolerance in Arabidopsis. Front Plant Sci, 2018. 9: p. 68 [PMID:29449855]