![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa02g071150.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 119aa MW: 12994.7 Da PI: 8.4887 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 110.6 | 7.4e-35 | 70 | 119 | 3 | 52 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvG 52
++ +kcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvG
Csa02g071150.1 70 DHPQKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVG 119
6789*********************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 2.0E-32 | 58 | 119 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 8.3E-30 | 71 | 119 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 26.496 | 73 | 119 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 75 | 111 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 119 aa Download sequence Send to blast |
MGLTSLQVCM DSDWLQEAES SGGSMLDSST TSPSAADILA ACSTRPQASA VAVAAAALMD 60 GGRRLRPPHD HPQKCPRCES THTKFCYYNN YSLSQPRYFC KTCRRYWTKG GTLRNIPVG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa02g071150.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK228992 | 1e-156 | AK228992.1 Arabidopsis thaliana mRNA for Dof zinc finger protein - like, complete cds, clone: RAFL16-29-O12. | |||
| GenBank | BT020467 | 1e-156 | BT020467.1 Arabidopsis thaliana At5g62940 gene, complete cds. | |||
| GenBank | BT020576 | 1e-156 | BT020576.1 Arabidopsis thaliana At5g62940 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006394333.2 | 3e-84 | dof zinc finger protein DOF5.6 | ||||
| Swissprot | Q9FM03 | 2e-84 | DOF56_ARATH; Dof zinc finger protein DOF5.6 | ||||
| TrEMBL | R0EWI4 | 5e-83 | R0EWI4_9BRAS; Uncharacterized protein | ||||
| TrEMBL | R0GQW6 | 7e-83 | R0GQW6_9BRAS; Uncharacterized protein | ||||
| STRING | XP_006280650.1 | 1e-83 | (Capsella rubella) | ||||
| STRING | XP_010444159.1 | 1e-83 | (Camelina sativa) | ||||
| STRING | XP_010459469.1 | 1e-83 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM6374 | 27 | 46 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62940.1 | 4e-76 | Dof family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




