PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa03008s010.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

HB-other

Protein Properties

Length: 163aa MW: 19202.6 Da PI: 8.7719

Description

HB-other family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa03008s010.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	64	2.1e-20	28	79	5	56
SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 +++t++q+++Le+ F+++++p++++r++L+++lgL rq+k+WFqNrR+++k Csa03008s010.1 28 HRHTPHQIQRLESTFNECQHPDEKQRTQLSRELGLAPRQIKFWFQNRRTQKK 79 689**********************************************988 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.84E-20	8	81	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	3.0E-22	10	75	IPR009057	Homeodomain-like
PROSITE profile	PS50071	17.767	21	81	IPR001356	Homeobox domain
SMART	SM00389	1.9E-18	22	85	IPR001356	Homeobox domain
Pfam	PF00046	5.3E-18	28	79	IPR001356	Homeobox domain
CDD	cd00086	2.92E-16	28	82	No hit	No description
PRINTS	PR00031	2.8E-5	52	61	IPR000047	Helix-turn-helix motif
PROSITE pattern	PS00027	0	56	79	IPR017970	Homeobox, conserved site
PRINTS	PR00031	2.8E-5	61	77	IPR000047	Helix-turn-helix motif

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 163 aa Download sequence Send to blast
MNMEFFGDSQ NHDGSETDKK NKKKKRFHRH TPHQIQRLES TFNECQHPDE KQRTQLSREL 60 GLAPRQIKFW FQNRRTQKKA QHERADNCAL KEENDKIRCE NIAIREAIKH AICPNCGDSP 120 LNDDAYFDEQ KLRIENAQLR DELERVSSIA AKFIGRPISH LPP

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that acts as negative regulator of trichome branching in association with HDG11 (PubMed:16778018). May regulate cell differentiation and proliferation during root and shoot meristem development (PubMed:25564655). Acts as positive regulator of SCL18/LAS expression (PubMed:25358340). {ECO:0000269\|PubMed:16778018, ECO:0000269\|PubMed:25358340, ECO:0000269\|PubMed:25564655}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa03008s010.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB493465	0.0	AB493465.1 Arabidopsis thaliana At1g17920 mRNA for hypothetical protein, partial cds, clone: RAAt1g17920.
GenBank	AF424554	0.0	AF424554.1 Arabidopsis thaliana At1g17920/F2H15_22 mRNA, complete cds.
GenBank	BT001050	0.0	BT001050.1 Arabidopsis thaliana At1g17920/F2H15_22 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010476956.1	1e-115	PREDICTED: homeobox-leucine zipper protein HDG12
Refseq	XP_010498167.1	1e-115	PREDICTED: homeobox-leucine zipper protein HDG12-like
Refseq	XP_019098435.1	1e-117	PREDICTED: homeobox-leucine zipper protein HDG12-like, partial
Swissprot	Q9LMT8	1e-103	HDG12_ARATH; Homeobox-leucine zipper protein HDG12
TrEMBL	R0IBH0	1e-105	R0IBH0_9BRAS; Uncharacterized protein
STRING	XP_010476956.1	1e-115	(Camelina sativa)
STRING	XP_010498166.1	1e-114	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM17003	6	11

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G17920.1	1e-105	homeodomain GLABROUS 12

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Tian C, et al. An organ boundary-enriched gene regulatory network uncovers regulatory hierarchies underlying axillary meristem initiation. Mol. Syst. Biol., 2014. 10: p. 755 [PMID:25358340] Horstman A, et al. AIL and HDG proteins act antagonistically to control cell proliferation. Development, 2015. 142(3): p. 454-64 [PMID:25564655]