![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa03g012250.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 182aa MW: 20773.5 Da PI: 9.9151 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 45.7 | 1.5e-14 | 43 | 88 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg++T E+ ++++ ++lG++ W++Ia++++ Rt++++k++w+++l
Csa03g012250.1 43 RGNFTSHEEGMIIHLQALLGNK-WASIASYLP-QRTDNDIKNYWNTHL 88
89********************.*********.************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 2.17E-20 | 24 | 98 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.5E-9 | 24 | 48 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 4.135 | 24 | 37 | IPR017877 | Myb-like domain |
| PROSITE profile | PS51294 | 22.681 | 38 | 92 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.6E-12 | 42 | 90 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.3E-12 | 43 | 88 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.74E-8 | 45 | 88 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 4.5E-20 | 49 | 93 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 182 aa Download sequence Send to blast |
MALETGDVFP PTLVIIFLIT WLLRCSKSCR LRWTNYLRPG IKRGNFTSHE EGMIIHLQAL 60 LGNKWASIAS YLPQRTDNDI KNYWNTHLKK KLNKSECDAE RSRSSENITL QTSASRNTIN 120 HRSTYASSTE NISRLLEGWM RASPKSSAAN HQTNSLIDHQ NHQSPYEQLQ GSWEQVKMLT 180 A* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 1e-17 | 24 | 93 | 40 | 109 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light) (PubMed:16005291, PubMed:21637967). Promotes guard cell deflation in response to water deficit. Triggers root growth upon osmotic stress (e.g. mannitol containing medium) (PubMed:21637967). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:21637967}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa03g012250.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by jasmonic acid (JA) and salicylic acid (SA) (PubMed:16463103). Triggered by auxin (IAA) in roots (PubMed:9839469, PubMed:21637967). Stimulated by light, UV-light and cold (PubMed:9839469). According to PubMed:16005291 and PubMed:23828545, rapidly repressed by abscisic acid (ABA) in an ABI1-dependent manner. But in contrast, according to PubMed:21637967, transiently induced by ABA in seedlings (PubMed:16005291, PubMed:21637967, PubMed:23828545). Rapidly repressed by drought. Activated by white light, but repressed by blue light and darkness (PubMed:16005291). Transiently induced by salt (NaCl) in seedlings. Induced by sucrose (PubMed:21637967). Positively regulated by SCAP1 (PubMed:23453954). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:21637967, ECO:0000269|PubMed:23453954, ECO:0000269|PubMed:23828545, ECO:0000269|PubMed:9839469}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK117469 | 1e-145 | AK117469.1 Arabidopsis thaliana At1g08810 mRNA for putative transcription factor, complete cds, clone: RAFL17-08-C21. | |||
| GenBank | AY519551 | 1e-145 | AY519551.1 Arabidopsis thaliana MYB transcription factor (At1g08810) mRNA, complete cds. | |||
| GenBank | BT005074 | 1e-145 | BT005074.1 Arabidopsis thaliana clone U50259 putative myb family transcription factor (At1g08810) mRNA, complete cds. | |||
| GenBank | DQ767951 | 1e-145 | DQ767951.1 Arabidopsis thaliana putative transcription factor (MYB60) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010489412.1 | 1e-109 | PREDICTED: myb-related protein 306-like | ||||
| Swissprot | Q8GYP5 | 3e-89 | MYB60_ARATH; Transcription factor MYB60 | ||||
| TrEMBL | R0GRH1 | 2e-94 | R0GRH1_9BRAS; Uncharacterized protein | ||||
| STRING | XP_010489412.1 | 1e-108 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G08810.1 | 1e-91 | myb domain protein 60 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




