PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa04g016070.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

MYB_related

Protein Properties

Length: 169aa MW: 18973 Da PI: 4.8335

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa04g016070.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	60.5	3.5e-19	10	55	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g +T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l Csa04g016070.1 10 KGTFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 55 799*****************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	4.2E-27	1	59	IPR009057	Homeodomain-like
SuperFamily	SSF46689	9.66E-18	1	59	IPR009057	Homeodomain-like
PROSITE profile	PS51294	28.727	5	59	IPR017930	Myb domain
SMART	SM00717	7.8E-19	9	57	IPR001005	SANT/Myb domain
Pfam	PF00249	2.2E-18	10	55	IPR001005	SANT/Myb domain
CDD	cd00167	1.19E-15	12	55	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 169 aa Download sequence Send to blast
MNYLSPNVKK GTFTEQEEDL IIRLHKLLGN RWSLIAKRVP GRTDNQVKNY WNTHLSKKLV 60 GDYSSAVKTT GDDENSPPSL FITATTTSSL HHQQENIYEN LAKDFDGIVS ASYEDKPKPE 120 PDQTGVLVAS TNDPSHYYGN NALWDHGDEF ELSSLVMMNF ASDIEYCL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	4e-17	2	59	51	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in leaves. Together with TTG1 and GL3, promotes trichome formation and endoreplication. Regulates the production of a signal that induces hair (trichome) precursor cells on leaf primordia to differentiate. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes (By similarity). {ECO:0000250, ECO:0000269\|PubMed:11063707, ECO:0000269\|PubMed:12356720, ECO:0000269\|PubMed:15361138, ECO:0000269\|PubMed:15728674, ECO:0000269\|PubMed:9625690}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa04g016070.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by gibberellins (PubMed:9625690). May be regulated by GEBP and GEBP-like proteins (PubMed:12535344). {ECO:0000269\|PubMed:12535344, ECO:0000269\|PubMed:9625690}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF495524	1e-167	AF495524.1 Arabidopsis thaliana R2R3-MYB transcription factor GL1 (MYB0) mRNA, complete cds.
GenBank	AY519590	1e-167	AY519590.1 Arabidopsis thaliana MYB transcription factor (At3g27920) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010507072.1	1e-124	PREDICTED: trichome differentiation protein GL1-like
Swissprot	P27900	1e-104	GL1_ARATH; Trichome differentiation protein GL1
TrEMBL	R0HNH3	1e-110	R0HNH3_9BRAS; Uncharacterized protein
STRING	XP_010507072.1	1e-123	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G27920.1	1e-107	myb domain protein 0

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Nayidu NK, et al. Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae. PLoS ONE, 2014. 9(4): p. e95877 [PMID:24755905] Sun L, et al. GLABROUS INFLORESCENCE STEMS3 (GIS3) regulates trichome initiation and development in Arabidopsis. New Phytol., 2015. 206(1): p. 220-30 [PMID:25640859] Yu D, et al. RPN1a, a subunit of the 26S proteasome, controls trichome development in Arabidopsis. Plant Physiol. Biochem., 2015. 88: p. 82-8 [PMID:25676129] Huang M,Hu Y,Liu X,Li Y,Hou X Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. Front Plant Sci, 2015. 6: p. 955 [PMID:26579186] Dai X, et al. A single amino acid substitution in the R3 domain of GLABRA1 leads to inhibition of trichome formation in Arabidopsis without affecting its interaction with GLABRA3. Plant Cell Environ., 2016. 39(4): p. 897-907 [PMID:26667588] Zheng K, et al. Ectopic expression of R3 MYB transcription factor gene OsTCL1 in Arabidopsis, but not rice, affects trichome and root hair formation. Sci Rep, 2016. 6: p. 19254 [PMID:26758286] Li Y, et al. Two IIIf Clade-bHLHs from Freesia hybrida Play Divergent Roles in Flavonoid Biosynthesis and Trichome Formation when Ectopically Expressed in Arabidopsis. Sci Rep, 2016. 6: p. 30514 [PMID:27465838] Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] Busta L,Hegebarth D,Kroc E,Jetter R Changes in cuticular wax coverage and composition on developing Arabidopsis leaves are influenced by wax biosynthesis gene expression levels and trichome density. Planta, 2017. 245(2): p. 297-311 [PMID:27730411] Maxwell DJ,Partridge JC,Roberts NW,Boonham N,Foster GD The effects of surface structure mutations in Arabidopsis thaliana on the polarization of reflections from virus-infected leaves. PLoS ONE, 2017. 12(3): p. e0174014 [PMID:28346494] García-Cano E,Hak H,Magori S,Lazarowitz SG,Citovsky V The Agrobacterium F-Box Protein Effector VirF Destabilizes the Arabidopsis GLABROUS1 Enhancer/Binding Protein-Like Transcription Factor VFP4, a Transcriptional Activator of Defense Response Genes. Mol. Plant Microbe Interact., 2018. 31(5): p. 576-586 [PMID:29264953] Kim SY,Hyoung S,So WM,Shin JS The novel transcription factor TRP interacts with ZFP5, a trichome initiation-related transcription factor, and negatively regulates trichome initiation through gibberellic acid signaling. Plant Mol. Biol., 2018. 96(3): p. 315-326 [PMID:29335898]