![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa04g050630.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 106aa MW: 11669 Da PI: 7.3508 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 83.9 | 2e-26 | 2 | 52 | 48 | 98 |
NF-YB 48 seasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98
s asdkcqrekrktingddllwa+atlGfe+y+eplk+yl++yre+eg++k
Csa04g050630.1 2 SRASDKCQREKRKTINGDDLLWAMATLGFEEYIEPLKLYLMRYREMEGDTK 52
579*********************************************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 4.0E-18 | 2 | 75 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 1.9E-23 | 2 | 73 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.3E-5 | 2 | 25 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 5.8E-11 | 8 | 26 | No hit | No description |
| PRINTS | PR00615 | 5.8E-11 | 27 | 45 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 106 aa Download sequence Send to blast |
MSRASDKCQR EKRKTINGDD LLWAMATLGF EEYIEPLKLY LMRYREMEGD TKGSAKGGDA 60 NAKKDGQSSQ NGQFPQLPNQ GSFSQGPYGN SQAQQHMMVP MSGTD* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 5e-18 | 2 | 46 | 49 | 93 | NF-YB |
| 4awl_B | 5e-18 | 2 | 46 | 50 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 5e-18 | 2 | 46 | 50 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa04g050630.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK353083 | 1e-104 | AK353083.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-13-K14. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010505265.1 | 4e-74 | PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X3 | ||||
| Refseq | XP_019100471.1 | 4e-74 | PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X4 | ||||
| Swissprot | Q8VYK4 | 3e-60 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A1J3K4I3 | 7e-62 | A0A1J3K4I3_NOCCA; Nuclear transcription factor Y subunit B-8 | ||||
| STRING | XP_010509397.1 | 2e-70 | (Camelina sativa) | ||||
| STRING | XP_010516951.1 | 2e-70 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1480 | 27 | 94 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 1e-62 | nuclear factor Y, subunit B8 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




