![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa05952s010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | CPP | ||||||||
| Protein Properties | Length: 113aa MW: 12582.4 Da PI: 6.9365 | ||||||||
| Description | CPP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCR | 54.8 | 1.9e-17 | 39 | 77 | 2 | 40 |
TCR 2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40
++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk
Csa05952s010.1 39 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 77
689**********************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM01114 | 4.2E-19 | 38 | 79 | IPR033467 | Tesmin/TSO1-like CXC domain |
| PROSITE profile | PS51634 | 19.901 | 39 | 113 | IPR005172 | CRC domain |
| Pfam | PF03638 | 4.4E-13 | 41 | 76 | IPR005172 | CRC domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 113 aa Download sequence Send to blast |
NETREDADQD VPVEPALQEL NLSSPKKKRV KLDSGEGDSC KRCNCKKSKC LKLYCECFAA 60 GVYCIEPCSC IDCFNKPIHE DTVLATRKQI ESRNPLAFAP KVIRNSDSVL ETG |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 24 | 31 | PKKKRVKL |
| 2 | 24 | 32 | PKKKRVKLD |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Plays a role in development of both male and female reproductive tissues. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa05952s010.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AL161539 | 3e-65 | AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39. | |||
| GenBank | CP002687 | 3e-65 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. | |||
| GenBank | Z97337 | 3e-65 | Z97337.2 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 2. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010440393.1 | 5e-74 | PREDICTED: protein tesmin/TSO1-like CXC 2 | ||||
| Refseq | XP_019089594.1 | 1e-74 | PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1 | ||||
| Refseq | XP_019089595.1 | 1e-74 | PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X2 | ||||
| Swissprot | F4JIF5 | 2e-71 | TCX2_ARATH; Protein tesmin/TSO1-like CXC 2 | ||||
| TrEMBL | A0A178UVP4 | 5e-69 | A0A178UVP4_ARATH; TCX2 | ||||
| TrEMBL | A0A1P8B4Y7 | 4e-69 | A0A1P8B4Y7_ARATH; TESMIN/TSO1-like CXC 2 | ||||
| TrEMBL | A0A1P8B4Z6 | 4e-69 | A0A1P8B4Z6_ARATH; TESMIN/TSO1-like CXC 2 | ||||
| TrEMBL | R0F1B1 | 5e-69 | R0F1B1_9BRAS; Uncharacterized protein | ||||
| STRING | XP_010440393.1 | 2e-73 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM15196 | 10 | 15 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14770.1 | 1e-55 | TESMIN/TSO1-like CXC 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




