![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa05g085440.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 124aa MW: 14273.4 Da PI: 11.0197 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 65.8 | 6.4e-21 | 2 | 57 | 38 | 93 |
EEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
B3 38 ledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93
+ + +g++W+++++y+++s++yvltkGW++Fvk+++L++gD+v+F+++ +++l+
Csa05g085440.1 2 VSNVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVTFQRSTGLDRQLY 57
67889*****************************************7655555455 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50863 | 13.394 | 1 | 66 | IPR003340 | B3 DNA binding domain |
| Pfam | PF02362 | 6.1E-18 | 2 | 60 | IPR003340 | B3 DNA binding domain |
| SuperFamily | SSF101936 | 7.85E-18 | 3 | 58 | IPR015300 | DNA-binding pseudobarrel domain |
| Gene3D | G3DSA:2.40.330.10 | 5.6E-22 | 4 | 64 | IPR015300 | DNA-binding pseudobarrel domain |
| CDD | cd10017 | 3.26E-15 | 4 | 49 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 124 aa Download sequence Send to blast |
MVSNVNGKVW RFRYSYWNSS QSYVLTKGWS RFVKEKNLRA GDVVTFQRST GLDRQLYIDW 60 KIRSGPRENP VQVVVRLFGV DIFNVNTVKP NDVVAVCGRK RSRDADDMFG LRCSRKQAII 120 NPL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wid_A | 4e-33 | 4 | 65 | 58 | 119 | DNA-binding protein RAV1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). Transcriptional repressor of flowering time on long day plants. Acts directly on FT expression by binding 5'-CAACA-3' and 5'-CACCTG-3 sequences (Probable). Functionally redundant with TEM1. {ECO:0000250, ECO:0000269|PubMed:18718758, ECO:0000305}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa05g085440.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB013887 | 1e-142 | AB013887.1 Arabidopsis thaliana mRNA for RAV2, complete cds. | |||
| GenBank | AC011665 | 1e-142 | AC011665.8 Arabidopsis thaliana chromosome 1 BAC T6L1 genomic sequence, complete sequence. | |||
| GenBank | AC011914 | 1e-142 | AC011914.9 Arabidopsis thaliana chromosome 1 BAC F14K14 genomic sequence, complete sequence. | |||
| GenBank | AF003101 | 1e-142 | AF003101.1 Arabidopsis thaliana AP2 domain containing protein RAP2.8 mRNA, partial cds. | |||
| GenBank | AF360312 | 1e-142 | AF360312.1 Arabidopsis thaliana putative DNA-binding protein(RAV2 (At1g68840) mRNA, complete cds. | |||
| GenBank | AY056361 | 1e-142 | AY056361.1 Arabidopsis thaliana putative DNA-binding protein RAV2 (At1g68840) mRNA, complete cds. | |||
| GenBank | CP002684 | 1e-142 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019083256.1 | 8e-78 | PREDICTED: AP2/ERF and B3 domain-containing transcription repressor RAV2 | ||||
| Swissprot | P82280 | 2e-76 | RAV2_ARATH; AP2/ERF and B3 domain-containing transcription repressor RAV2 | ||||
| TrEMBL | R0IF20 | 3e-75 | R0IF20_9BRAS; Uncharacterized protein | ||||
| STRING | XP_010415512.1 | 3e-77 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM848 | 27 | 121 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G68840.2 | 6e-79 | related to ABI3/VP1 2 | ||||




