![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa06709s010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 138aa MW: 14884.7 Da PI: 10.7608 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 126.1 | 1.1e-39 | 18 | 76 | 3 | 61 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
+ lkcprCds+ntkfCyynny+l+qPr+fCk+CrryWt+GGalrnvPvGgg+rkn+k+
Csa06709s010.1 18 DGPLKCPRCDSSNTKFCYYNNYNLTQPRHFCKGCRRYWTQGGALRNVPVGGGCRKNNKK 76
56789***************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 1.0E-33 | 3 | 71 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 1.9E-33 | 20 | 75 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 29.637 | 21 | 75 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 23 | 59 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 138 aa Download sequence Send to blast |
MGGSMAERAR QAKIPPPDGP LKCPRCDSSN TKFCYYNNYN LTQPRHFCKG CRRYWTQGGA 60 LRNVPVGGGC RKNNKKGKNG NSKSSSSSSK QSSTVNAPSP SSGQLRTNHQ FPFSPTLYNL 120 TQLGGIGLNL AATNGNNQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). Involved in the regulation of root development (PubMed:23057675). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Element of a regulatory network controlling indole glucosinolates (IGS) biosynthesis, probably by inducing the expression of accurate genes (e.g. CYP83B1). Promotes apical dominance (PubMed:16740150). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:16740150, ECO:0000269|PubMed:23057675, ECO:0000269|PubMed:30626969}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa06709s010.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin and salicylic acid (SA) (PubMed:10758484). Induced transiently in response to the generalist herbivore S.littoralis. Triggered by methyl jasmonate (MeJA) and wounding (PubMed:16740150). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:16740150}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF155816 | 0.0 | AF155816.1 Arabidopsis thaliana zinc finger protein OBP2 mRNA, complete cds. | |||
| GenBank | AY062715 | 0.0 | AY062715.1 Arabidopsis thaliana Strong similarity to zinc finger protein OBP2 (At1g07640; F24B9.30) mRNA, complete cds. | |||
| GenBank | AY093351 | 0.0 | AY093351.1 Arabidopsis thaliana strong similarity to zinc finger protein OBP2 (At1g07640) mRNA, complete cds. | |||
| GenBank | CP002684 | 0.0 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
| GenBank | F24B9 | 0.0 | AC007583.2 Arabidopsis thaliana chromosome 1 BAC F24B9 sequence, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010487779.1 | 2e-96 | PREDICTED: dof zinc finger protein DOF1.1-like isoform X3 | ||||
| Refseq | XP_010497593.2 | 2e-96 | PREDICTED: dof zinc finger protein DOF1.1, partial | ||||
| Swissprot | Q8L9V6 | 4e-83 | DOF11_ARATH; Dof zinc finger protein DOF1.1 | ||||
| TrEMBL | Q2V4Q1 | 1e-80 | Q2V4Q1_ARATH; Dof-type zinc finger DNA-binding family protein | ||||
| STRING | XP_010487767.1 | 2e-95 | (Camelina sativa) | ||||
| STRING | XP_010497593.1 | 1e-95 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM5336 | 17 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G07640.1 | 2e-75 | Dof family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




