![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa06g042820.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 144aa MW: 15325.1 Da PI: 4.5966 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 181.8 | 5.8e-57 | 22 | 119 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
vreqdr+lPian+srimk++lP n+ki+kdak+tvqecvsefisf+tseasdkcq+ekrkt+ngddllwa+atlGfedy+eplk+yl++yreleg
Csa06g042820.1 22 VREQDRYLPIANISRIMKRALPPNGKIGKDAKDTVQECVSEFISFITSEASDKCQKEKRKTVNGDDLLWAMATLGFEDYLEPLKIYLARYRELEG 116
69********************************************************************************************* PP
NF-YB 96 ekk 98
++k
Csa06g042820.1 117 DNK 119
975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.7E-53 | 20 | 131 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.64E-41 | 25 | 137 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.4E-27 | 28 | 92 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 4.8E-21 | 56 | 74 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 59 | 75 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 4.8E-21 | 75 | 93 | No hit | No description |
| PRINTS | PR00615 | 4.8E-21 | 94 | 112 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 144 aa Download sequence Send to blast |
MADINTPSSP AGDGGESGGG SVREQDRYLP IANISRIMKR ALPPNGKIGK DAKDTVQECV 60 SEFISFITSE ASDKCQKEKR KTVNGDDLLW AMATLGFEDY LEPLKIYLAR YRELEGDNKG 120 SGKSGDGSNR DAGGAVPGEE LPV* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-48 | 22 | 113 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-48 | 22 | 113 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa06g042820.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK318866 | 1e-170 | AK318866.1 Arabidopsis thaliana AT2G38880 mRNA, complete cds, clone: RAFL17-11-H19. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010517210.1 | 1e-100 | PREDICTED: nuclear transcription factor Y subunit B-1 | ||||
| Refseq | XP_010517211.1 | 1e-100 | PREDICTED: nuclear transcription factor Y subunit B-1 | ||||
| Swissprot | Q9SLG0 | 1e-92 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
| TrEMBL | Q3EBK1 | 6e-91 | Q3EBK1_ARATH; AT2G38880 protein | ||||
| STRING | XP_010517210.1 | 1e-99 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1480 | 27 | 94 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.3 | 3e-74 | nuclear factor Y, subunit B1 | ||||




