![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa07482s010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 82aa MW: 8964.91 Da PI: 10.2314 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 50.2 | 8.2e-16 | 12 | 68 | 71 | 128 |
NAM 71 gkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
g++k+r + gyW+at k++ + ++ vg k++L +y g++p+g+k dW+m+ey l
Csa07482s010.1 12 GRQKKRGSNGGYWSATVAAKKINA-GNGIVGYKTILDYYVGKQPNGVKGDWLMQEYWL 68
677888999**************9.9999***************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 19.758 | 1 | 82 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 3.4E-18 | 10 | 75 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.1E-6 | 15 | 67 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 82 aa Download sequence Send to blast |
RTKLGKGGGR GGRQKKRGSN GGYWSATVAA KKINAGNGIV GYKTILDYYV GKQPNGVKGD 60 WLMQEYWLES SSSDDDHNNE NK |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa07482s010.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010431409.1 | 1e-52 | PREDICTED: NAC transcription factor 29-like | ||||
| Refseq | XP_010497634.1 | 6e-53 | PREDICTED: NAC transcription factor 29-like, partial | ||||
| TrEMBL | D7LVH1 | 1e-30 | D7LVH1_ARALL; Uncharacterized protein | ||||
| STRING | XP_010427482.1 | 3e-52 | (Camelina sativa) | ||||
| STRING | XP_010497634.1 | 2e-52 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2793 | 15 | 63 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G56530.1 | 2e-24 | NAC domain containing protein 64 | ||||




